HPV Impfstoffe: derzeitiger Stand und Entwicklungenggg-b.de/_download/unprotected/hpv_impfung_...

download HPV Impfstoffe: derzeitiger Stand und Entwicklungenggg-b.de/_download/unprotected/hpv_impfung_  

of 42

  • date post

    23-Jul-2018
  • Category

    Documents

  • view

    213
  • download

    0

Embed Size (px)

Transcript of HPV Impfstoffe: derzeitiger Stand und Entwicklungenggg-b.de/_download/unprotected/hpv_impfung_...

  • AMK

    Berliner Gynkologische Gesellschaft

    15.2.2012

    HPV Impfstoffe: derzeitiger Stand und Entwicklungen

    Achim SchneiderAndreas M. KaufmannKlinik fr GynkologieCharit Campus Benjamin Franklin und Campus MitteBerlin, Germanyandreas.kaufmann@charite.de GTI@CBF

  • AMK

    Teil I: Klinische Anwendung

    HPV Impfung

  • Weltweite Besttigungen:

    HPV Impstoffe sind

    Hchst immunogen Hchst sicher Hchst effektiv Hchst unterschtzt

  • 4 Gissmann

    Rambout et al., 2007

    HPV Impfung: Nebenwirkungen?

  • Stand: Impfquoten Deutschland

    Hype Verunsicherung Schaden

    Konsequenzen: Stopp von Werbung keine Korrektur durch Gesundheitsexperten/Medien keine/wenige positive Medienberichte

    Medienberichte ber 2 Todesflle in zeitlicher Nhe zur Impfung

    13 Gesundheitsexperten kommentieren

    Bezahlung d. einzelne KKs

    STIKO Empfehlung

    GBA: Finanzierung 12-17 Jhrige

    30%

    57%

  • HPV Impfung: GardasilImpfeffekte Australien: Rapid decline in warts after national Quadrivalent HPV vaccine programEinfhrung der HPV Impfung 4/2007 (12-18), 7/2007 (bis 26) organisiertes schulbasiertes Impfprogramm, und Allgemeinmediziner

    Auswertung: Sentinel STI Klinik Melbourne, 36.055 Patienten 1/2004 bis 12/2008 Anteil der Personen mit neuen Condylomata acuminata 2004-2007 (pr-vaccine) verglichen zu 2008 (post vaccine) Monatliche Zahlen fr Frauen

  • 2004 2006 2008

    Inzidenz GW

    Jahre

    homosexuelle Mnner

    ltere Frauen (>28)

    (schematische Darstellung nach: Fairley 2009, Brotherton 2011)

    junge Frauen (

  • AMK AMK

    HPV Nachweisbarkeit und Alter 11.851 Frauen in Dnemark

    0

    10

    20

    30

    40

    50

    60

    15-1

    8 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 54 56 5860

    -62

    66-6

    875

    +

    HR

    LR

    % u

    nte

    rsuchte

    r Fra

    uen

    Krger-Kjaer, et al. 2007

    Low-risk HPV frhere Infektion und schnellere Warzenentwicklung

    high-risk HPV sptere Infektion und langsamere Dysplasieentwicklung

  • Brotherton J, Lancet 2011; 377: 208592

    Impfung ImpfungAbnahme hochgradiger Befunde an der Zervix(PAP)

  • Einfluss der Impfung auf Rate der operativen Eingriffe

    Paavonen J, et al. Lancet 2009; 374:301314.

    Ca. 140.000 Konisationen in Deutschland p.a.!

  • Postkonisations-Impfung?Effektivitt gezeigt fr beide Impfstoffe!

    Gardasil: Schutz vor Wieder-Erkrankung nach Therapie:

    Geimpfte haben eine 65% geringere Rate an Wieder-Erkrankung in nur 1,4 Jahren Beobachtungszeit. (Joura et al. EUROGIN, Monte Carlo, Febr. 17-20, 2010)

    Cervarix Garland: vergleichbare Daten aus PATRICIA Studie

    (S.M. Garland et al. Eurogin, Lissabon, Mai 2011)

  • 1.11.

    Kontrolle

    9.325 Frauen

    HPV-16/18

    Vakzine

    9.319 Frauen

    ZweiterkrankungCIN

    Keine ZweitErkrankung

    zur Diff. Kolposkopie

    1.107 Frauen

    % Reduktion der neuen CIN

    zur Diff. Koloposkopie

    1.235 Frauen

    Fallzhlung 60 Tage nach der

    1. therapeutischer Manahme

    S.M. Garland oral Present Eurogin Mai 2011 LissabonPaavonenJ et al Lancet 2007; 369: 2161-70, Paavonen et al Lancet 2009; 374:301-14

    PATRICIA Studie mit Cervarix -Studiendesign Zweiterkrankung CIN

    PATRICIA

    18.644 Frauen

    16-26 Jahre

    1.11.

    1.CIN

    Therapiepflichtig

    190 Frauen

    1.CIN

    Therapiepflichtig

    264 Frauen

    ZweiterkrankungCIN

    Keine ZweitErkrankung

    Insgesamt wurden zur Differentialkolposkopie berwiesen

    2.458 Frauen in der Vakzine Gruppe2.723 in der Kontrollgruppe

  • Studienergebnisse - unabhnging vom HPV Typ und vom HPV Status zu Studienbeginn

    Endpunkt

    CervarixN=190

    KontrolleN=264 Wirksamkeit

    n n % 96.1% CI

    CIN 1+ 12 22 42,6 -21,1 74,1

    CIN 2+ 1 9 88,2 14,8 99,7

    EndpunkteEffektivitt der HPV-16/18 Vakzine gegen Zweit- oder andauernde CIN fr Frauen, die sich whrend der PRATRICIA Studie einer Therapie wegen einerCIN unterziehen mussten (post hoc Analyse)

    S.M. Garland oral Present Eurogin Mai 2011 LissabonPaavonen J et al Lancet 2007; 369: 2161-70, Paavonen et al Lancet 2009; 374:301-14

  • Schlussfolgerung - aus der Vergleichsstudie

    Die Inzidenz von neu aufgetretenen CIN 2+ und CIN 1+ (unabhngig vom HPV Typ und vom HPV Status und zytologischen Befund zu Studienbeginn) war in der HPV-16/18 Vakzine Gruppe niedriger im Vergleich zur Kontrollgruppe

    Die Effektivitt der HPV-16/18 Vakzine gegen CIN 2+ ist hoch

    Frauen, die sich nach der (zu spten) Impfung mit der HPV-16/18 Vakzine einer CIN Therapie unterziehen mssen, knnen einen anhaltenden Benefit durch die Reduktion einer Zweiterkrankung an CIN 1+ oder CIN 2+ erwarten

    S.M. Garland oral Present Eurogin Mai 2011 Lissabon

  • SIKO Empfehlung Schsische Impfkommission empfiehlt und begrndet

    die Impfung ALLER FRAUEN bis 26 Jahre

    rzteblatt Sachsen 01/2011:www.slaek.de/50aebl/2011/archiv/01/pdf/0111_006.pdf

    EMA: europische Zulassung beider Impfstoffe ab 9 Jahre, keine obere Altersgrenze!

  • 1825 jhrige

    71%

    < 1%

    1517 jhrige

    80%

    < 1%

    Bisher keine Infektion mit

    HPV 16 and 18

    HPV 16 oder HPV 18 sero+/DNA-

    HPV 16 oder 18

    HPV 16 und 18

    Sero- und DNA-

    DNA+

    DNA+HPV-16: 5.5%HPV-18: 2%

    HPV-16: 16%HPV-18: 12%

    HPV-16: 5%HPV-18: 2.5%

    HPV-16: 9%HPV-18: 7%

    HPV Nachweis bei Frauen von 15 25 Jahren PATRICIA Studie bei 18.644 Studienteilnehmerinnen

    Apter et al. Eurogin 2010.

  • AMK

    Antragsformulare und begrndende Literatur fr die Krankenkassen zu:

    HPV Impfung ber 18 Jahre HPV Impfung nach Konisation

    download unter:

    http://frauenklinik.charite.de/aktuelles

    Beitrag: Neues zur HPV-Impfung

  • Estimating the potential cost-effectiveness of human papillomavirus (HPV) vaccination in Germany using a

    dynamic transmission model

    Compared with current screening practice, vaccination of 12-year-old girls prevented an estimated additional 100,000 cervical cancer cases (reduction by 37%) and 24,000 deaths (reduction by 30%) over a time horizon of 100 years.

    the discounted ICERs were: (below 50.000 per QALY is cost efficient) Bivalent: 53,807 per life-year gained and 34,249 per QALY Quadrivalent: 30,910 per life-year gained and 14,711 per QALY

    Model results highly sensitive to assumptions about the discount rate, vaccination age and vaccine uptake.

    Inclusion of indirect costs lowered (improved) the cost-effectiveness ratios by20 to 40 percent depending on the choice of vaccine.

    vaccine-specific cross-protection benefits yielded cost-effectiveness ratios of 24,576 per QALY (cervical cancer reduction of 119.000 cases) for the bivalent

    vaccine and 11.429 per QALY (cervical cancer reduction of 113.000 cases) for the quadrivalent

    vaccine.

    Damm et al., ISPOR 2011

  • Effektivitt bei Mnnern (Gardasil)

    Condylomata acuminata in allen Mnnern 89% (ATP); 67% (ITT)

    Anale HPV Infektion und AIN in MSM 16-26 Jahre Persist. Infektion: 94,9% (ATP); 59,4% (ITT) AIN HPV6, 11, 16, 18: 77,5% (ATP); 50,3% (ITT) AIN alle HPV: 54,9% (ATP); 25,7% (ITT)

    => Impfempfehlung fr Jungen (USA: CDC-ACIP)11-12 jhrige Jungen

    Palefsky et al., NEJM 365:17, 1576-85 (2011)

    Giuliano and Palefsky et al., N Engl J Med:364:401-11 (2011)

  • AMK

    Teil II: Forschung

    InfektionT-Zellimmunologie

  • Infektionsablauf und Virus-Rezeptoren

    Basallamina

    Mikrotrauma, ECM Exposition

    Bindung an Heparansulphat,Furinspaltung

    Transfer auf zellulren Rezeptor,Infektion sich teilender Zelle

    E2

    E2

    passive Freisetzung

    Day et al., J VIROL 82:4638 (2008)

  • Virus Binding and Entry

    Basement Membrane (ECM)

    Heparin sulphate

    proteoglycans(HSPGs)

    Basal Cell

    Conformationalchange

    Furincleavage

    Cyclophilin BTetraspanin

    CD151

  • AMK

    Hohe anhaltende Antikrpertiter

    HPV lange extrazellulr deponiert an ECM

    Wunde = Lymphaustritt mit IgG Serumantikrpern

    Hohe Effektivitt der HPV Impfstoffe:

  • Antikrperantworten

    kurzlebige Plasmazelle

    B Gedchtniszelle

    Serum-konzentration

    ruhende B-ZelleAktivierung

    langlebige Plasmazelle

    unspezifische Proliferation

    Ig class switch,Plasmazell-

    Differenzierung

    Zeit

    T Helfer Zelle

    anamnestische Antwort, Antigen

    Reexposition

    T Helfer Zelle

  • HPV spezifische T-Helferzellfrequenz ber ein Jahr (ex vivo, 5 BE im Impfverlauf)

    Gardasil Cervarix

    Pacher and Rosenthal et al., IPVC, Malm, 2010

  • HPV11 L1 255 RHFFNRAGTVGEPVPDDLLVKGG--NNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVD 332HPV18 L1 319 RHFWNRAGTMGDTVPQSLYIKGT--GMRASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVD 396HPV31 L1 259 RHFFNRSGTVGESVPTDLYIKGS--GSTATLANSTYFPTPSGSMVTSDAQIFNKPYWMQRAQGHNNGICWGNQLFVTVVD 336HPV45 L1 285 RHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSITTSDSQLFNKPYWLHKAQGHNNGICWHNQLFVTVVD 364BPV1 L1 254 RHIWTRGGSEKEAPTTDFYLKNNK-GDATLKIPSVHFGSPSGSLVSTDNQIFNRPYWLFRAQGMNNGIAWNNLLFLTVGD 332

    HPV16 L1 336 TTRSTNMSLCAAISTS-ETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTL 414HPV6 L1 332 TTRSTNMTLCASVTTS--STYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTL 409HPV11 L1 333 TTRSTNMTLCASVSKS--ATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTL 410HPV18 L1 397 TTRSTNLTICASTQS