T A N D E MNeuigkeiten

NEWS - BERRIAK - NOVEDADESMATERIAL DIDACTICO E INFORMACIONES PARA PROFESORADO DE IDIOMAS

Januar Enero 2004 Nr 26

Contenido Inhalt0 Informaciones breves Kurzinformationen (Impressum Bezugsbedingungen Buumlrooumlffnungszeiten) 01 Umstellung von Papier auf PDF

1 Alemaacuten Deutsch ua verbreitete Sprachen11 Arbeitsblaumltter Spiele im Internet MUDs und Simulationen Suchapparate fuumlr Kinder und

Jugendliche

2 Euskara eta beste hizkuntzak Baskisch und andere Minderheiten- sprachen

21 Gilen Humboldt Kultur Elkartea Baskisch an VHS Baskischkurs fuumlr Deutsche 22 wwwtandemcityinfoeu_indexhtml neues Web von Tandem auf Baskisch23 wwwhatorcomherriahtm virtuelle Stadt auf Baskisch

3 Formacioacuten Fortbildung31 COINED CoacuterdobaAR Oportunidad Educativa - Taacutendem para joacutevenes de pocos recursos

econoacutemicos32 Rezension von Fundacioacuten Esplai et al CD Intercambios internacionales Int Exchange 33 Marion Dauch Tandem als Moumlglichkeit im akademischen Raum

4 Tandem en el mundo Tandem in der Welt 41 Istituto Venezia + Tandem Koumlln + COINED Self-descriptions42 wwwtandemcityinfo Mitglieder- und Lizenzinhaberlisten43 Wer ist wer in Tandem

5 Tandemreg Fundazioa Die Tandemreg-Stiftung 51 Arbeitsplan 2004 52 Rights and Duties (castellanodeutschenglish)

53 T International + T Fundazioa Lizenzvertrag (deutsch) 54 Das Letzte

Bezugsbedingungen

Dieser Rundbrief geht kostenlos und automa-tisch an alle Mitglieder die LizenzinhaberIn-nen die Foumlrdermitglieder und ausgewaumlhlteKontaktpersonen Er kann nicht abonniertwerden aber gegen andere Publikationenausgetauscht

Er erschien urspruumlnglich mit je etwa 30 Seitendreimal jaumlhrlich (Januar April Oktober) DieSeitenzahl wurde schrittweise zugunsten vonInternetpublikation reduziert Inzwischenverlangt die spanische Post die TN als Briefzu frankieren Daher werden sie ab Nr 26 nurnoch als PDF versandt Den Acrobat Readerkann mensch kostenlos bei wwwadobede wwwadobees wwwadobecom bekommen

Von Nr 21 April 2002 bis 24 erhielt jedesMitgliedLizenzinhaber zwei Exemplare (fuumlrVerwaltung und LehrerInnenTandemvermit-tlerInnen) Die PDF-Version kann und sollteinnerhalb der Tandem-Einrichtungen massen-haft weiterversendet werden

Beitraumlge mit einer Laumlnge von bis zu 10 Seiten(muumlssen nicht auf Deutsch sein) sind unswillkommen wenn sie auf einer Diskette(DOSWindows fuumlr IBM-kompatibleFormate Word 6 RTF) oder per E-Mail (bittenur Rich Text Format ) eingeschickt werdenWir lektorieren die Artikel nicht und schickendemr AutorIn ein Exemplar des naumlchstenRundbriefs mit seinemihrem Artikel zu AuchBeitraumlge von ausserhalb des Tandem-Netzessind willkommen

Redaktionsschluss ist der 1 des Erscheinungs-monats Versand gegen Monatsende

Die Tandem-Neuigkeiten haben eineISSN-Nummer und Artikel in ihnen

sind eine Zeitschriftenveroumlffentlichung

Die Hauptsprache des Rundbriefs ist Deutschwir nehmen aber sehr gern auch Artikel inanderen Sprachen an

Redaktion Nr 26 Juumlrgen Wolff

Die Verantwortung fuumlr die in Artikelnausgedruumlckten Meinungen liegt bei ihrenAutorInnen bei Nachdrucken aus anderenZeitschriften bei deren Redaktion oderAutorInnen

Depoacutesito legal etc Impressum

Tandemreg FundazioaPKApdo 864

E-20080 Donostia San Sebastiaacuten

CIF G 20471587Sede Social c Duque de Mandas 21

Tel + Fax INT-34-943-322062 (10-13h)

Declaracioacuten de utilidad puacuteblica Orden 2698 paacuteg 9013 BO Paiacutes Vasco del 11-07-1994

ISSN 1137-2257 Depoacutesito Legal SS-127996

Permiso editorial del Ministerio de Cultura del 16-06-87

Editada e impresa en Donostia San Sebastiaacuten

Homepage wwwtandemcityinfo +wwwtandem-forg

E-mail tandemtandem-forgNetzintern networktandem-forg

Oumlffnungszeiten des Stiftungsbuumlros

Das Stiftungsbuumlro ist folgendermaszligen besetztgrundsaumltzlich telefonisch von 10-13 h Das Fax ist immer betriebsbereit es muszlig per Faxnicht per Telefon angewaumlhlt werden damit derautomatische Diskriminator das Fax erkennt unddarauf umschaltet

Tage an denen das Stiftungsbuumlro aufgrund vonReisen oder Osterpause schlieszligt

8-103 253-24 8-184

In dieser Zeit wird die E-Mail weiterbearbeitettandemtandem-forg

fuumlr Mitglieder und LizenzinhaberInnennetworktandem-forg

Wahrscheinlich finden Sie aber alles mit derSuchmaschine auf den Homepages und denWebuumlbersichten

wwwtandem-forgpagessitemaphtmwwwtandemcityinfode_indexhtml

1 Deutsch und andere verbreitete Sprachen

11 Arbeitsblaumltter

Juegos didaacutecticos en linea para el aprendizaje de idiomas (= Spiele)

El siacutembolo lsquo~rsquo se escribe manteniendo apretada la tecla lsquoaltrsquo y escribiendo con las teclasnumeacutericas a la derecha sucesivamente lsquo1 2 6rsquo

Deutsch ldquoSpielerdquo

wwwblinde-kuhde

English ldquoGamesrdquo

httpgamesyahoocomgamesyahooliganshtml

wwwkidsfreewarecom

wwwblinde-kuhdesprachen ldquoMemo Englischrdquo

Euskera ldquoJokuakrdquo

wwwkaixocom

wwwaurkicom

httpes-eualtavistacom

Franccedilais ldquoJeuxrdquo

wwwexploriancom

wwwlardonscom

wwwblinde-kuhdesprachen ldquoMemo Franzoumlsischrdquo

Juumlrgen Wolff Tandem Fundazioa Stand 5-1-2004

Multi-User Dungeons (MUD) + M Object Oriented (MOO)

Deutsch

Liste wwwmuddeDML ldquoDeutschrdquo

MUD httptamedhonat (Telnet)

English

List wwwmuddeDML ldquoEnglishrdquo

MOO httplinguautdallasedu7000 (www Java)

Franccedilais

Liste wwwumsledu~moosprojmoofrancaishtml

MOO httpadmiralumsledu7779 (www Java)

Simulation globale

English

httpprojectsedtechsandinetlangacadlecirque tambieacuten interesante Project 1776

Franccedilais

wwwciepfrcarnetadFLEsimulahtm Iles

Odyssee

Deutsch

wwwgoethededllproodysseeinfohtm

Juumlrgen Wolff TANDEM Fundazioa Stand 20-1-2004

Buscadores para nintildes + joacutevenes + estudiantes de idiomas + profesorado (= Suchapparate fuumlr Kinder + Jugendliche)

wwwgooglecom y versiones linguumliacutesticas diferentes

Deutsch

wwwblinde-kuhde

English (UK + USA)

wwwsssplashcom ()

wwwyahooliganscom

httpsunsiteberkeleyeduKidsClick ()

wwwajkidscom

wwwukfavoritesforkidscom ()

wwwberitsbestcom ()

httpcybersleuth-kidscom

Euskera (helduentzat)

wwwkaixocom

wwwaurkicom

httpes-eualtavistacom

wwwgoogleeseu

Franccedilais

wwwlardonscom

wwwexploriancom

Juumlrgen Wolff TANDEM Fundazioa Stand 20-1-2004

2 Euskara eta beste hizkuntzak Baskisch und andereMinderheitensprachen

21 Gilen Humboldt Kultur Elkartea Baskisch an deutschen VolkshochschulenBaskischkurs fuumlr Deutsche

Der baskisch-deutsche Kulturverein Gilen Humboldt bemuumlht sich unter anderem um dieVerbesserung der Moumlglichkeiten fuumlr Deutschsprachige Baskisch zu lernen

Projekte fuumlr 2004

Kongress Herritik Herri Euskal Herritik Europara Euskararen Lurra Lantzen Building bridges cultivatinglanguages and their lands vom 22 bis 24 Maumlrz 2004 in Arratia vorgestellt von Jasone Aldekoa(Kooperationsprojekt)

Wanderausstellung uumlber deutsch-baskischen Schuumlleraustausch (siehe oben)

Zweites Schachturnier deutsch-baskischer Partnerstaumldte in Schwarzenbruck

Treffen deutsch-baskischer Freundschaftsvereine am 2425 Juli in Gernika Ziel der Koordination der Aktiv-itaumlten und des Aufbaus einer web-Seite

Baskisch-Intensivkurs fuumlr Deutsche in Gernika vom 267 bis 1382004

Baskischunterricht an deutschen Volkshochschulen ab September 2004

Symposium uumlber deutsch-baskische Kulturbeziehungen am 21 Oktober 2004 in der UPV in Vitoria-Gasteiz

Anfragen (koumlnnen auf Deutsch sein) direkt an humboldteuskalnetnetWegen des Kurses in Gernika und den VHS empfiehlt es sich erst ab 10 Maumlrz zu schreibenda derzeit die Bedingungen noch nicht ganz klar sind

22 wwwtandemcityinfoeu_indexhtml Neues Web

Als zweite Sprachversion des neuen Webs der Stiftung ist die baskische gestartet Der Einstiegerfolgt uumlber obige Adresse der Sprachwechsel funktioniert noch nicht Hinweise auf Fehlerwie nicht funktionierende Links bitte an den Webmaster networktandem-forgEs folgen die spanische und die englische

23 wwwhatorcomherriahtm Eine virtuelle Stadt auf Baskisch

Allmaumlhlich gibt es virtuelle Staumldte nicht nur in den grossen Sprachen (siehe 11) sondern dankder Stiftung Aurten Bai jetzt auch auf BaskischIm Web wwwhatorcom ist ein Teil eine baskische Stadt Um sich zu orientieren muss menschauf Metro klicken dann erscheint ein Linienplan der die Webuumlbersicht darstelltBeispielsweise gibt es in Mintzuli Itzulpenak die Moumlglichkeit kurze Uumlbersetzungen kostenloskorrigiert zu bekommen Allerdings gibt es (immer noch) keinen automatischenUumlbersetzungsapparat und vollstaumlndige Uumlbersetzungen werden nach einem Voranschlagberechnet

Durch die Verwendung von Java usw kann es bei einer normalen Telefonleitung ziemlichlange dauern bis die Stadt aufgebaut ist (Auch Rom wurde nicht an einem Tage erbaut )

3 Formacioacuten Fortbildung

31 COINED CoacuterdobaArgentina Oportunidad Educativa Taacutendem para joacutevenesde pocos recursos econoacutemicos

Un programa del nuevo miembro de TANDEM International acreditado recientemente porTandem Fundazioa ofrece la oportunidad de volver a usar el enfoque taacutendem en un campo queya nos preocupoacute en los inicios y que se ha ido perdiendo un poco Se trata de usar taacutendemcomo forma de aprender idiomas que no requiere grandes instalaciones y mucha inversioacutenpara que personas de de pocos recursos econoacutemicos (que son la mayoriacutea de ls habitantes delmundo ) puedan practicar idiomas y conocer otras culturas Lo describe Fernanda Rojas asi

El programa de Oportunidad Educativa es quizaacutes el aacutembito maacutes favorable paradesarrollar un proyecto de parejas Tandem ya que por un lado estaacute dirigido aestudiantes argentinos de alto rendimiento acadeacutemico y bajos recursoseconoacutemicos y por otro lado se invita a participar libremente en diferentes tareas anuestros estudiantes extranjeros

En ambos grupos hay varios intereses compartidos como el de aprenderingleacutesespantildeol estar en contacto con personas de otra cultura diferente de lapropia y predisposicioacuten por conocer cosas nuevas A su vez para ambos gruposhay algunas ventajas extras Para nuestros estudiantes argentinos por el hecho deprovenir de un grupo social de escasos recursos rara vez tienen la posibilidad deestar en contacto con extranjeros lo que despierta en ellos gran curiosidad yentusiasmo al momento de compartir cualquier actividad con alguien de otro paiacutesTienen una predisposicioacuten especial para contarles sobre sus costumbres gustos ycultura en general y a su vez grandes deseos de descubrir coacutemo se vive y coacutemoes la gente de otros lugares

Para nuestros estudiantes internacionales tambieacuten representa una ventaja extra yaque durante su estadiacutea en el paiacutes llegaraacuten a conocer mucha gente del lugar perorara vez se relacionan con estudiantes de estos barrios cadenciados Por estarazoacuten ademaacutes de aprender el idioma de manera real e interactiva lograraacuten obtenerun panorama maacutes completo de la sociedad Argentina

El proyecto se desarrollariacutea en el aacutembito de nuestra escuela de Coacuterdoba ya que esdonde nuestros estudiantes extranjeros toman clases de espantildeol y nuestros estudi-antes argentinos reciben clases de apoyo entre ellas de ingleacutes Esto permitiraacute quela mediacioacuten y el seguimiento resulte maacutes faacutecil ademaacutes de poder contar conespacio suficiente para realizar los encuentros en la escuela misma si fueranecesario

En general nuestros becados tienen entre 15 y 18 antildeos por lo que el tema de laedad no representaraacute un inconveniente

Para contactar con COINED ver la autodescripcioacuten en 41

32 Rezension von Fundacion Esplai et al CD Intercambios internacionales Intercanvis Internacionals International Exchange Eacutechanges internationaux Intercacircmbios internacionais

Agradecemos al equipo EDEX (wwwedexes) el habernos facilitado un ejemplar para estavaloracioacuten

Este CD compatible con PC y Mac es fruto de un proyecto subvencionado por el programaeuropeo Youth realizado por la Fundacio Catalana Esplai la Fundaccedilao da Juventude laIrish Youth Foundation y Versant Sud en cooperacioacuten con fundaciones de otros paises Estaacute pensado para monitores de intercambios en tiempo libre y se centra en la educacioacuten parala paz que se entiende en tres vertientes

1) interior consigo mismo2) con ls demaacutes3) con la naturaleza

Se sigue el esquema metodoloacutegico de a) propuestab) preparacioacutenc) realizacioacutend) valoracioacuten analizando tambieacuten los factores facilitadores y obstaculizadores de forma concreta

La navegacioacuten conduce a traveacutes de fotos esquemas muchos textos cortos y tambieacuten algunaslecturas largasTal vez se puede notar que no hay mencioacuten del enfoque taacutendem en el CD a pesar de habermuchas experiencias con intercambios juveniles Esto es un indicador que todaviacutea no hemosllegado a todos los sitios donde deberiacutean conocernos Por su presentacioacuten amena y lenguaje claro con muchos ejemplos este CD es uacutetil comoherramienta de autoestudio o de comentario en grupo para monitoresas joacutevenes El disponerde versiones linguumlisticas en Castellano Catalaacuten Ingleacutes Franceacutes y Portugueacutes en el mismo CDes una gran ventaja para intercambios multinacionales

Para entidades que no lo consiguen gratuitamente el precio de ventas es de 15 euro

Maacutes informacioacuten fundacioesplaiorg o wwwedexes

33 Marion Dauch Tandem als Moumlglichkeit im akademischen Raum

Diese Arbeit zum Ersten Staatsexamen die sich auf Erfahrungen mit einer Tandemvermittlungim Rahmen des ERASMUS-Programmes an der Universitaumlt Bremen und Arabischkurse stuumltztund vom DiploMagisterservice mitbetreut wurde enthaumllt in Visionen eine Vielzahl originellerIdeen wie Kochtandem Lesungstandem Filmtandem und ein Tandem-Cafeacute neben den schonweitgehender genutzten Moumlglichkeiten wie e-Mail Chat und MOO Insofern ist sie fuumlr diezahlreichen studentischen Initiativen die an Unis Tandems vermitteln eine wertvolle Hilfe

32 Rezension von Fundacion Esplai et al CD Intercambios internacionales Intercanvis Internacionals International Exchange Eacutechanges internationaux Intercacircmbios internacionais

Agradecemos al equipo EDEX (wwwedexes) el habernos facilitado un ejemplar para estavaloracioacuten

Este CD compatible con PC y Mac es fruto de un proyecto subvencionado por el programaeuropeo Youth realizado por la Fundacio Catalana Esplai la Fundaccedilao da Juventude laIrish Youth Foundation y Versant Sud en cooperacioacuten con fundaciones de otros paises Estaacute pensado para monitores de intercambios en tiempo libre y se centra en la educacioacuten parala paz que se entiende en tres vertientes

1) interior consigo mismo2) con ls demaacutes3) con la naturaleza

Se sigue el esquema metodoloacutegico de a) propuestab) preparacioacutenc) realizacioacutend) valoracioacuten analizando tambieacuten los factores facilitadores y obstaculizadores de forma concreta

La navegacioacuten conduce a traveacutes de fotos esquemas muchos textos cortos y tambieacuten algunaslecturas largasTal vez se puede notar que no hay mencioacuten del enfoque taacutendem en el CD a pesar de habermuchas experiencias con intercambios juveniles Esto es un indicador que todaviacutea no hemosllegado a todos los sitios donde deberiacutean conocernos Por su presentacioacuten amena y lenguaje claro con muchos ejemplos este CD es uacutetil comoherramienta de autoestudio o de comentario en grupo para monitoresas joacutevenes El disponerde versiones linguumlisticas en Castellano Catalaacuten Ingleacutes Franceacutes y Portugueacutes en el mismo CDes una gran ventaja para intercambios multinacionales

Para entidades que no lo consiguen gratuitamente el precio de ventas es de 15 euro

Maacutes informacioacuten fundacioesplaiorg o wwwedexes

33 Marion Dauch Tandem als Moumlglichkeit im akademischen Raum

Diese Arbeit zum Ersten Staatsexamen die sich auf Erfahrungen mit einer Tandemvermittlungim Rahmen des ERASMUS-Programmes an der Universitaumlt Bremen und Arabischkurse stuumltztund vom DiploMagisterservice mitbetreut wurde enthaumllt in Visionen eine Vielzahl originellerIdeen wie Kochtandem Lesungstandem Filmtandem und ein Tandem-Cafeacute neben den schonweitgehender genutzten Moumlglichkeiten wie e-Mail Chat und MOO Insofern ist sie fuumlr diezahlreichen studentischen Initiativen die an Unis Tandems vermitteln eine wertvolle Hilfe

Sie kann bei Tandem Fundazioa angefordert werden und wird als PDF per zip komprimiertkostenlos an alle Mitglieder Lizenzinhaber und Foumlrdermitglieder versandt

4 Tandem en el mundo Tandem in der Welt

41 Selfdescriptions of new licensees of Tandem Fundazioa or members of TandemInternational Istituto Venezia Tandem Koumlln eV iG COINED CoacuterdobaAR(graphic errors are a result of scanning process not of the originals)

Organization ISTITUTO VENEZIA

Legal status SRL (LTD) Address DORSODURO 3116A Postal CodeCityCountry 30123 VENICE ITALY Telephone (39) 0415224331 Office hours 9-17 Fax 0415285628 E-Mail infoistitutoveneziacomwwwistitutoveneziacom Contact personrepresentative MATTEO SAVINI E-Mail saviniistitutoveneziacom Languages spoken english (good) french (interm) understood same

Person in charge of Tandem mediation MATTEO SAVINI

E-Mail

Languages spoken understood

Explication of your interest in the tandem method Please inform about the following points in German English French Italian or Spanish (this will bepublished for all TANDEM members and licensees and should be at least one page)

1- Foreign-language learning in your country In Venice is tought at University English French Spanish GermanJapanese Chinese Arab

2- Your expectations from the tandem method I think we can help our students to get in touch with the many italian students who are willing toimprove their knowledge language skill and open their mind to new horizons

3- Tandem projects you are already developing or planning a) individual tandem b) tandem in parallel courses

4- Languages you expect to be used in the coursesEnglish German 5- Desired geographical area Venice and the Veneto Region

6- Other remarks and suggestionsIstituto Venezia has a very good location in terms of helping people to meet each other being in themiddle of the venetian university area

42 wwwtandemcityinfo Mitglieder und LizenzinhaberInnen von Tandem Fundazioa

Die Mitgliederliste befindet sich auf wwwtandemcityinfotandemde43_TFmitgliederhtmdie LizenzinhaberInnen auf wwwtandemcityinfotandemde43_TFlizenzenhtmdie Mitglieder von Tandem International das eine Globallizenz fuumlr sie alle zusammen hat aufwwwtandem-schoolscom

43 Wer ist wer in TANDEM

Nach den Reformen ist es nicht einfach die neue Struktur auf einen Blick zu verstehen Daherdieses Who is who von wwwtandemcityinfo

International (E-Mail) Tandem NetworkVon Helmut Brammerts am Seminar fuumlr Sprachlehrforschung der Ruhr-Universitaumlt Bochumab 1994 verwendeter Name fuumlr ein universitaumlres E-Mail-Projekt das von der EU finanziellgefoumlrdert wurde Es wurde danach auf alle Arten von Internetkontakten ausgeweitet

ParvisSelbstfinanzierte Vermittlungsagentur fuumlr E-Mail-Partnerschaften mit Rechtssitz in den USALizenzinhaber von Tandem Fundazioa und Kooperationspartner von Tandem International (wwwetandemlearningcom) Ein Teil des Teams arbeitete vorher in der Tandem Agency

Tandem AgencyAgentur zur kostenlosen Vermittlung von E-Mail-Partnerschaften die mit EU-Zuschuumlssenvom International (E-Mail) Tandem Network am Seminar fuumlr Sprachlehrforschung der Ruhr-Universitaumlt Bochum (wwwslfruhr-uni-bochumde) eingerichtet wurde

Tandem CommunityVom Webmaster von Tandem International Juan Ancosmez eingerichteter Treffpunkt imInternet fuumlr alle die an Tandem und Sprachaustausch interessiert sind(wwwtandem-schoolscomindexphp)

Tandem DonostiaSammelbegriff fuumlr die Tandemprojekte im baskischen DonostiaSan Sebastiaacuten Beim VereinCentro interCultural Tandem Kulturarteko Elkartea war lange die Koordination des Tandem-Netzes durch Juumlrgen Wolff ansaumlssig 1994 entstand daraus Tandem Fundazioa und derKulturverein wurde in die private Sprachschule Centro de Idiomas Donostia Tandem SanSebastiaacuten umgewandelt

Tandem Fundazioa1994 durch Stiftung seiner WarenzeichenMarkenrechte von Juumlrgen Wolff gegruumlndetegemeinnuumltzige Stiftung zur LehrerInnenfortbildung und Materialentwicklung Bis 2003 wurdesie von den Tandem-Schulen verwaltet und war fuumlr die Ausweitung des Tandem-Netzeszustaumlndig Seitdem vergibt sie die Lizenzen zur Verwendung von Tandem-Methode undMarke und spezialisiert sich auf die Verbesserung der Qualitaumlt der Tandem-Vermittlung(wwwtandem-fundazioaorg und wwwtandem-forg)

Tandem International

2002 gegruumlndeter Verein von Sprachschulen mit Lizenz von Tandem Fundazioa der eingemeinsames Web (wwwtandem-schoolscom) einen gemeinsamen Webmaster und einengemeinsamen Koordinator finanziert um die Kurse seiner Mitglieder zu verkaufen und denVerein auszuweiten

Tandem (International) KoordinatorOliver Lechlmair (coordinatortandem-schoolscom) Angestellter von Tandem Internationalals Ansprechpartner fuumlr Schulen die in Tandem International eintreten wollen

Tandem-NetzAb 1984 verwendete Bezeichnung fuumlr die Kooperation der Vereine und Sprachschulen diesich gegenseitig AustauschpartnerInnen und SprachkursteilnehmerInnen vermittelten Es gabMitglieder (=Sprachschulen) und AssoziierteMitglieder des Wissenschaftlichen Beirats(=Oumlffentliche Einrichtungen)

Tandem-Server BochumVon Helmut Brammerts und Karin Kleppin betrieben durch Umbenennung des International(E-Mail) Tandem Network-Servers entstanden (wwwslfruhr-uni-bochumde)

Tandem-SchuleBezeichnet eine gemeinnuumltzige oder private Schule die das Recht zur Verwendung der MarkeTandem hat und (in sehr unterschiedlichem Ausmass) Aktivitaumlten mit Tandem-Sprachaustausch durchfuumlhrt

Tandem-StiftungDeutsche Uumlbersetzung des baskischen Namens Tandem Fundazioa

Stand 1 Februar 2004

5 Tandemreg Fundazioa Die Tandemreg-Stiftung

51 Activities Plan 2004(Staff 2 persons total 075 and students in practices )

1 Alemaacuten Deutsch German

12 Formacioacuten a distancia para profesorado de alemaacutenLE FernstudiumDaF-LehrerInnen Distance training for teachers of GermanFL

Distribution of materials about lsquoLerntechnikenrsquo extension of web about Kontakteknuacutepfen and Arbeitsblaumltter fuacuter Internet fuacuter DaF-Projekte

15 Alemaacuten por intercambio Deutsch durch Austausch German by exchange

Exposition lsquoLanguage learning by exchange and internetrsquo using experiences of the 5 yearsproject in Zarautz on behalf of the Gilen Humboldt Society in the German School ofDonostiaSan Sebastiaacuten

2 Euskara Baskisch Basque

21 Autoaprendizaje + formacioacuten Selbstlernkursefortbildung Self Access courses +training

Maintaining of training offers for euskaltegis and ikastolas about readingcomprehension study techniques and autonomy mnemotechniques motivation byexchangesrsquo lsquointernet in classroomrsquo error analysis conferences about study techniquesfor Basque learners and for schools Material for exchanges in basque on the web

22 Euskara para extranjers Baskisch fuumlr AuslaumlnderInnen und Kulturprogramm Basque for foreigners and cultural programs

Answers to single enquiries updating of web cooperation with Gilen Humboldt German-Basque Society

24 Mugaz Gain (Cooperacioacuten transfronteriza Grenzuumlberschreitende Zusammenar-beit Cross border cooperation)

Distribution of book + diskette for cross border projects Mugaz Gain - Tandem acrossthe borders Beispiele fuumlr grenzuumlberschreitenden Sprach- und KulturaustauschTrainings with the material and congress conferences (cooperation with

CICERO-Coordination)Publication of an article in English French and Spanish edited by the Deputacioacuten

(Provincial government of Gipuzkoa)

27 Traduccioacuten Uumlbersetzung Translations

For internal use publications (specially Tandem Intermediator Quality Handbook) and webs by practiceships of Tecnical Universities (FHS) and revised web-translation

3 Formacioacuten Fortbildung Teacher training

31 Meacutetodo taacutendem Tandem-Methodik Tandem method

Introduction by self study package with tutorisation (EnglishFrenchGermanSpanish)and in areas with request by presence courses

lsquoTandem Updatersquo for intermediators trained years ago and modules for specific purposesand in TI plenaries

Follow-up of the work on tandem intermediation tandem courses on behalf ofalphabetaSucircdtirol-I

Feasibility study for lsquoePatentinorsquo (Sucircdtirol bilingualism exams preparation by eLearningand eTandem)

Distribution of Babylonia-Tandem Praxishandbuch zur rezeptiven Mehrsprachigkeit incooperation of alphabetaI and Tandem EdicionesE

Conferences about receptive multilingualismIntegration of all available materials creation of a frequently asked questions-guide for

tandem intermediators and definition of the proposed quality criteria integration in an eLearn-ing environment

Participation with Universitaumlt of LinzA Goethe-InstitutD alphabetaI and others in aMINERVA project about eLearning to find out criteria and evaluation software for combinedforms of e- and presence language learning (blended learning)

Coordination of a research project about different forms of tandem intermediation andcounseling with Universidad of SevillaE Universitaumlt of GiessenD University of IllinoisUSA

Publishing of a module tandem intermediation in the Tandem Network for the program ofParvis and presence courses in the training of e-tandem counselors

Classification of all available materials improving of material supply by InternetTandem-Neuigkeiten as web publication make copies available in electronic formatSupport to Diplom-Magister-Doktor publications and practiceships in the tandem litera-

ture bankTwo practiceships for material translators diplomands about tandem methodology

32 Investigacioacuten y formacioacuten general Allgemeine Forschung und Fortbildung General research and training

Conferences at public schoolsEOIVHS congress conferences in Spain and Germany andcourses on behalf of CPRCEPCFIECOP and UniversitiesMain topics for teacher training offers Exchanges InformaticsInternet Use of one

language for learning the next one Foreign languages in primary schoolsGerman teacher training course on behalf of Goethe-Institut MuumlnchenD

33 Interkultur-Tandem

Distribution of the TF dokuments and the guide-book published by VWV Wien

4 Red Tandem Tandem-Netz Tandem Network

41 Marca Warenzeichen Trade mark

Improvement of information of members and licensees specially responsibles of publicityand webdesign to prevent trade mark conflictsrationalisation of resolution of conflicts and cost reduction by charging the infractors with

all

42 Ampliacioacuten de la red Netz-Ausweitung Network extension

After implementation of new structure refreshing of all pendingdelayed contacts of 2003by standardized information coordinated with TIIntensified campaign towards public institutions combined with teacher trainingsSpecial action for new licensees with the 10th anniversary of TFAll basic informations on Internet updating of the lsquoFAQrsquo according the new structure

concentration on direct contacts with interested people

43 Correspondencia interior Netz-Korrespondenz Network correspondence

Updating of Tandem data base (members licensees sponsors other interested)

44 Ayuda al marketing Marketing-Unterstuumltzung Marketing support

Standardized forwarding of interested people to schools and TI marketing responsiblereduction of mislead people through lsquoTandem-Cityrsquo wwwtandemcityinfo Distribution of folders in all courses and conferences

45 Desarrollo de calidad Qualitaumltssicherung Quality standards

Concentration on quality of tandem intermediation support by development of the guide-book in cooperation with alphabeta Publication of criteria list to facilitate autonomous control for language learners

X Interna

X1 Publicidad Werbung Publicity

Enforcement of web presence continuous registering in the main search enginesCombination of E-Mailings and post mailings for teacher trainingConversion of lsquoTandem-Neuigkeitenrsquo in web publicationCampaign towards all public institutions dealing with tandem to put a link on

lsquowwwtandemcityinforsquo Fusion of wwwtandemcityinfo and wwwtandem-fundazioaorg in one structure easy to

navigate

X7 Caja contabilidad y plan financiero Kasse Buchhaltung Finanzplanung Accounting amp Finances

Improve self-financement and go on with devolution of debths with employees

lsquoTandem Updatersquo for intermediators trained years ago and modules for specific purposesand in TI plenaries

Follow-up of the work on tandem intermediation tandem courses on behalf ofalphabetaSucircdtirol-I

Feasibility study for lsquoePatentinorsquo (Sucircdtirol bilingualism exams preparation by eLearningand eTandem)

Distribution of Babylonia-Tandem Praxishandbuch zur rezeptiven Mehrsprachigkeit incooperation of alphabetaI and Tandem EdicionesE

Conferences about receptive multilingualismIntegration of all available materials creation of a frequently asked questions-guide for

tandem intermediators and definition of the proposed quality criteria integration in an eLearn-ing environment

Participation with Universitaumlt of LinzA Goethe-InstitutD alphabetaI and others in aMINERVA project about eLearning to find out criteria and evaluation software for combinedforms of e- and presence language learning (blended learning)

Coordination of a research project about different forms of tandem intermediation andcounseling with Universidad of SevillaE Universitaumlt of GiessenD University of IllinoisUSA

Publishing of a module tandem intermediation in the Tandem Network for the program ofParvis and presence courses in the training of e-tandem counselors

Classification of all available materials improving of material supply by InternetTandem-Neuigkeiten as web publication make copies available in electronic formatSupport to Diplom-Magister-Doktor publications and practiceships in the tandem litera-

ture bankTwo practiceships for material translators diplomands about tandem methodology

32 Investigacioacuten y formacioacuten general Allgemeine Forschung und Fortbildung General research and training

Conferences at public schoolsEOIVHS congress conferences in Spain and Germany andcourses on behalf of CPRCEPCFIECOP and UniversitiesMain topics for teacher training offers Exchanges InformaticsInternet Use of one

language for learning the next one Foreign languages in primary schoolsGerman teacher training course on behalf of Goethe-Institut MuumlnchenD

33 Interkultur-Tandem

Distribution of the TF dokuments and the guide-book published by VWV Wien

4 Red Tandem Tandem-Netz Tandem Network

41 Marca Warenzeichen Trade mark

Improvement of information of members and licensees specially responsibles of publicityand webdesign to prevent trade mark conflictsrationalisation of resolution of conflicts and cost reduction by charging the infractors with

all

42 Ampliacioacuten de la red Netz-Ausweitung Network extension

After implementation of new structure refreshing of all pendingdelayed contacts of 2003by standardized information coordinated with TIIntensified campaign towards public institutions combined with teacher trainingsSpecial action for new licensees with the 10th anniversary of TFAll basic informations on Internet updating of the lsquoFAQrsquo according the new structure

concentration on direct contacts with interested people

43 Correspondencia interior Netz-Korrespondenz Network correspondence

Updating of Tandem data base (members licensees sponsors other interested)

44 Ayuda al marketing Marketing-Unterstuumltzung Marketing support

Standardized forwarding of interested people to schools and TI marketing responsiblereduction of mislead people through lsquoTandem-Cityrsquo wwwtandemcityinfo Distribution of folders in all courses and conferences

45 Desarrollo de calidad Qualitaumltssicherung Quality standards

Concentration on quality of tandem intermediation support by development of the guide-book in cooperation with alphabeta Publication of criteria list to facilitate autonomous control for language learners

X Interna

X1 Publicidad Werbung Publicity

Enforcement of web presence continuous registering in the main search enginesCombination of E-Mailings and post mailings for teacher trainingConversion of lsquoTandem-Neuigkeitenrsquo in web publicationCampaign towards all public institutions dealing with tandem to put a link on

lsquowwwtandemcityinforsquo Fusion of wwwtandemcityinfo and wwwtandem-fundazioaorg in one structure easy to

navigate

X7 Caja contabilidad y plan financiero Kasse Buchhaltung Finanzplanung Accounting amp Finances

Improve self-financement and go on with devolution of debths with employees

42 Ampliacioacuten de la red Netz-Ausweitung Network extension

After implementation of new structure refreshing of all pendingdelayed contacts of 2003by standardized information coordinated with TIIntensified campaign towards public institutions combined with teacher trainingsSpecial action for new licensees with the 10th anniversary of TFAll basic informations on Internet updating of the lsquoFAQrsquo according the new structure

concentration on direct contacts with interested people

43 Correspondencia interior Netz-Korrespondenz Network correspondence

Updating of Tandem data base (members licensees sponsors other interested)

44 Ayuda al marketing Marketing-Unterstuumltzung Marketing support

Standardized forwarding of interested people to schools and TI marketing responsiblereduction of mislead people through lsquoTandem-Cityrsquo wwwtandemcityinfo Distribution of folders in all courses and conferences

45 Desarrollo de calidad Qualitaumltssicherung Quality standards

Concentration on quality of tandem intermediation support by development of the guide-book in cooperation with alphabeta Publication of criteria list to facilitate autonomous control for language learners

X Interna

X1 Publicidad Werbung Publicity

Enforcement of web presence continuous registering in the main search enginesCombination of E-Mailings and post mailings for teacher trainingConversion of lsquoTandem-Neuigkeitenrsquo in web publicationCampaign towards all public institutions dealing with tandem to put a link on

lsquowwwtandemcityinforsquo Fusion of wwwtandemcityinfo and wwwtandem-fundazioaorg in one structure easy to

navigate

X7 Caja contabilidad y plan financiero Kasse Buchhaltung Finanzplanung Accounting amp Finances

Improve self-financement and go on with devolution of debths with employees

X9 Distribucioacuten de libros Buchversand Book sales

Distribution of Dokuments of 4 and 5 ITT and other books supported by web catalogueDistribution of Babylonia-Tandem oder Sprachenparadies Praxishilfe zur rezeptiven

MehrsprachigkeitDistribution of Mugaz Gain - Tandem uumlber die Grenzen Beispiele fuumlr grenzuumlberschre-

itenden Sprach- und KulturaustauschDistribution of trial version of Tandem intermediators Quality Guidebook

52 Rights and Duties (Castellano Deutsch English)

Some rights and things to do have changed with the reform Here you find the most updatedversion of your opportunities and what you should observe If you are a Tandem Internationalmember please look also at 53

TANDEM FUNDAZIOA1 CASTELLANO Informacioacuten sobre asociacioacuten y licencias 2 DEUTSCH Information uumlber Mitgliedschaft und Lizenzen 3 ENGLISH Information about membership and licences 4 Cuotas Beitraumlge Fees5 Su interlocutor Ihr Ansprechpartner Your interlocutor

1 CASTELLANO

Estimads colegas

su institucioacuten estaacute interesada en rdquoser miembro de la Fundacioacuten Tandemrdquo opcioacuten para universidades e instituciones deaprendizaje similares que no ofrecen cursos de idiomas abiertos al pugraveblico general peroque desean implementar internamente o en programas de intercambio el sistema Tandemo una licencia de uso del meacutetodo Tandem opcioacuten para cualquier entidad o escuela quetiene un intereacutes fundamentado en la aplicacioacuten del meacutetodo Tandem en la organizacioacuten deintercambios linguacuteiacutesticos y culturales o siendo una escuela de idiomas para extranjers quiere hacerse socio de la asociacioacutenTandem International y esto incluye la licencia de uso del meacutetodo Tandem

Tanto el ser miembro como el tener una licencia ofrece las siguientes ventajas

Uso del material desarrollado por la Red Tandem sin pagar derechos de autor p ej laserie de artiacuteculos contenidas en el Paquete de autoestudio sobre el meacutetodo TandemSugerencias para rdquoParejas Tandemrdquo que practiquen los idiomas albano alemaacuten aacuterabebugravelgaro castellano checo daneacutes esloveno franceacutes hugravengaro ingleacutes italiano letoacuten portugueacutes polaco serbocroata turco y vasco (fotocopias yo disquetes)

Sugerencias para la comprensioacuten de textos para Parejas Tandem profesionales enalemaacuten castellano checo esloveno franceacutes ingleacutes italiano portugueacutes y vasco (fotoco-pias yo disquetes) Recepcioacuten gratuita de las uacuteltimas publicaciones de cada momento por ejemplo libros yCDs sobre el Babylonia-Tandem multilinguumle o el programa transfronterizo Mugaz GainParticipacioacuten en seminarios de formacioacuten de la Fundacioacuten por dos tercios del precio y

opcioacuten a la organizacioacuten conjunta de tales cursos Participacioacuten de tods ls empleads (incluidos contratads por horas) en los cursos de idiomas de las aprox 25 escuelas de TANDEM International en todo el mundo con undescuento actualmente del 20 Atencioacuten a estudiantes universitaris y de doctorado que trabajen con el tema Tandem y acceso a plazas de praacutecticasOrientacioacuten por medio de registros de investigacioacuten y acceso a nuestro material (biblioteca) servicio de fotocopias a distanciaPosibilidad de organizar el Congreso Jornadas Internacionales Tandem en su propia institucioacutenEnviacuteo gratuito del boletiacuten TANDEM-Neuigkeiten tres veces al antildeoInformacioacuten raacutepida sobre nuestros proyectos de investigacioacuten u otros asesoriacutea y bolsa de contactosPara miembros derecho al uso del logotipo TANDEM y a la mencioacuten del estatusrdquoMiembro de la Fundacioacuten Tandemrdquo para licenciatarios mencioacuten del estatus Usuarioregistrado del meacutetodo TANDEM

Aparte de los servicios concretos la asociacioacuten o licencia ofrece conexioacuten con una red decientiacutefics y profesoresas por el momento en trece paises que cuentan con gran experienciaen el aacuterea de intercambio cultural y de idiomas

Los derechos y deberes se describen maacutes exactamente en los Estatutos

27N Miembros del PatronatoPodraacuten admitirse como miembros entidades que cumplan con los siguientes requisitosa) forma legal como institucioacuten puacuteblica asociacioacuten de utilidad puacuteblica y similares que no usen la marcalsquoTANDEMrsquo para publicidad para vender cursos de idiomas La Junta Directiva de la Fundacioacuten podraacute admitirotras formas para paiacuteses donde no existen estas formas legalesb) existir las suficientes garantiacuteas de estabilidad de la entidad c) una linea pedagoacutegica que incluya la ampliacioacuten o sustitucioacuten del papel tradicional del profesorado por elmeacutetodo taacutendem y ensentildeanza comunicativa un enfoque intercultural y la presencia de diferentes culturas entreel personal

27a N LicenciasPodraacuten otorgarse licencias del uso de los textos que forman parte del patrimonio fundacional y de la marcaTANDEM a entidades dedicadas a la ensentildeanza de idiomas y al contacto intercultural en general que tenganintereacutes fundamentado en la aplicacioacuten del meacutetodo taacutendem

31N Derechos de los miembrosLos miembros tendraacuten el derecho dea) participar en las Asambleas Generales con voz y voto y elegir controlar y destituir todos los oacuterganos de laFundacioacutenb) presentarse a eleccioacuten para todos los oacuterganos de la Fundacioacutenc) usar la denominacioacuten Usuario reconocido del meacutetodo TANDEM con el logotipo de la Fundacioacuten

d) usar el material protegido por el registro ante el Registro de Propiedad Intelectual de Madrid nuacutemero128568 y todo el material para actividades taacutendem elaborado por miembros del Patronatoe) realizar intermediacioacuten individual taacutendem y cursos combinados con ellaf) participar en todos los proyectos de la Fundacioacuten g) publicar sus experiencias a no ser que lo impidan otras disposiciones de estos estatutosh) recibir formacioacuten de la Fundacioacuten en condiciones maacutes favorables que el puacuteblico en generali) que todosas sus empleadosas participen en cursos de idiomas de tandem International en condiciones maacutesfavorables que el puacuteblico en general

31 b N Derechos de los licenciatarios Los licenciatarios tendraacuten el derecho dea) informarse sobre la gestioacuten de la Junta Directiva y asistir con voz sin voto a las asambleas del Patronatob) solicitar el paso a ser miembrorsquo cuando cumplan con los requisitosc) usar la denominacioacuten Usuario registrado del meacutetodo TANDEMasi como los derechos mencionados en 31 d) e) f) g) h) i)Se pueden definir derechos adicionales por contrato

32N Deberes de los miembrosLos miembros tendraacuten el deber dea) poner la frase usuario reconocido del meacutetodo TANDEM con el logotipo de la Fundacioacuten y la direccioacutenwwwtandemcityinfo en toda su publicidad referida al meacutetodo taacutendemb) no realizar actividades taacutendem seguacuten artiacuteculo 7 despueacutes de darse de baja del Patronatoc) informar al departamento defensa de la marca TANDEM de la Fundacioacuten sobre infracciones en su ambitode actuacioacutend) pagar las aportacionese) respetar el tope maacuteximo que se cobraraacute por una intermediacioacuten taacutendem fijado anualmente por el Patronatof) enviar un ejemplar de cada publicacioacuten referente a la metodologiacutea taacutendem y de sus folletos gratuitamente ala Fundacioacuteng) exponer de forma permanente un cartel facilitado por la Fundacioacuten sobre el meacutetodo taacutendem con indicacioacutendela responsable de intermediaciones taacutendem de la entidad y su horarioh) comunicar nombre y direccioacuten electroacutenica de su responsable de intermediacioacuten a la Fundacioacuteni) enviar una circular anual sobre su situacioacuten y actividades a todos los miembros del Patronatoj) participar en las Asambleas del Patronato y organizarlask) como proteccioacuten ante plagios antildeadir el siacutembolo reg o detraacutes de TANDEM o insertar una nota a pieacute depaacutegina en textos cientiacuteficosl) exponer la publicidad de los demaacutes miembros y licenciatarios en su sede y mencionar la Fundacioacuten en suspublicaciones referidas a taacutendem como interlocutora para entidades interesadas en hacerse miembro delPatronato o licenciatariom) antes de iniciar actividades en una ciudad donde haya otro miembro o licenciatario informarlon) (fundido con m)o) comunicar a la Fundacioacuten entidades que puedan ser miembros o licenciatarios potencialessuprimido (p) q) r) no intentar registrar la marca TANDEM por si sola o combinada para la propia entidads) no tener participaciones en empresas que infrinjan estos deberes(t) suprimidou) formar alla responsable de intermediaciones taacutendem por el curso presencial o a distancia de la Fundacioacutenv) actualizar la formaciones al menos cada 5 antildeos por curso presencial o a distancia de la Fundacioacutenw) aplicar los criterios de calidad de la intermediacioacuten taacutendem que desarrolle la Fundacioacuten

32 b N Deberes de los licenciatariosLos licenciatarios tendraacuten el deber dea) poner la frase Usuario registrado del meacutetodo TANDEM y la direccioacuten wwwtandemcityinfo owwwtandemcitycom en toda su publicidad referida al meacutetodo taacutendemb) no realizar actividades taacutendem seguacuten artiacuteculo 7 despueacutes de darse de baja del Patronatoc) informar a la Fundacioacuten sobre infracciones en su ambito de actuacioacutend) pagar las aportacionese) respetar el tope maacuteximo que se cobraraacute por una intermediacioacuten taacutendem fijado anualmente por el Patronato(f) suprimido)g) enviar un ejemplar de cada publicacioacuten referente a la metodologiacutea taacutendem y de sus folletos gratuitamente ala Fundacioacuten

h) exponer de forma permanente un cartel facilitado por la Fundacioacuten sobre el meacutetodo taacutendemi) comunicar nombre y direccioacuten electroacutenica de su responsable de intermediacioacuten taacutendem a la Fundacioacutenj) facilitar anualmente los datos estadiacutesticos sobre el uso del meacutetodo taacutendem que requiera la Fundacioacutenk) como proteccioacuten ante plagios antildeadir el siacutembolo reg o detraacutes de TANDEM o insertar una nota a pieacute depaacutegina en textos cientiacuteficosl) exponer la publicidad de los demaacutes miembros en su sede y mencionar la Fundacioacuten en sus publicacionesreferidas a taacutendem como interlocutora para entidades interesadas en hacerse miembro del Patronato olicenciatariom) antes de iniciar actividades en una ciudad donde haya otro miembro o licenciatario informarlor) no intentar registrar la marca TANDEM por si sola o combinada para la propia entidads) no tener participaciones en empresas que infrinjan estos deberesSe pueden definir deberes adicionales por contrato

2 DEUTSCH

LiebeR KollegIn

Sie interessieren sich fuumlr die Mitgliedschaft Ihrer Einrichtung in der Tandem-Stiftung Dieser Status wurde fuumlrUniversitaumlten und aumlhnliche oumlffentliche oder vergleichbare Einrichtungen geschaffen diekeine Sprachkurse auf dem freien Markt anbieten aber Tandem intern und inAustauschprojekten verwenden moumlchtenoder eine Lizenz zur Verwendung der Tandem-Methode das Angebot fuumlr alleEinrichtungen oder Schulen die ein begruumlndetes Interesse an der Anwendung derTandem-Methode in Sprach- und Kulturaustauschprogrammen habenoder Sie moumlchten als Sprachschule fuumlr AuslaumlnderInnen Mitglied des Vereins TandemInternational werden und das schliesst die Lizenz zur Verwendung der Tandem-Methodemit ein

Sowohl die Mitgliedschaft als auch die Lizenz bieten folgende Vorteile

Benutzung des im TANDEM-Netz entwickelten Materials ohne CopyrightvorbehaltzB die im Selbstlernkurs zur Einfuumlhrung in Tandem enthaltenen ArtikelTipps fuumlr Einzeltandems auf albanisch arabisch baskisch bulgarisch daumlnisch deutschenglisch franzoumlsisch italienisch lettisch polnisch portugiesisch serbokroatischslowenisch spanisch tschechisch ungarisch tuumlrkisch (Fotokopiervorlagen undoderDisketten)Tipps zum Leseverstehen fuumlr Fachtandems auf baskisch deutsch englisch franzoumlsischitalienisch portugiesisch slowenisch spanisch tschechisch (Fotokopiervorlagen undoderDisketten)die jeweils neusten Veroumlffentlichungen (Buumlcher und CDs) zB zum Babylonia-Tandemund grenzuumlberschreitenden Mugaz Gain-Tandem kostenlosTeilnahme an den Fortbildungsveranstaltungen der Stiftung zum 23-Preis und Moumlglichkeitzur gemeinsamen Veranstaltung von FortbildungskursenTeilnahme aller Angestellten (auch Honorarkraumlfte) an allen Sprachkursen an den rund 25 Tandemschulen auf der ganzen Welt mit Rabatt derzeit von 20 Betreuung von DiplomandInnen und DoktorandInnen bei Arbeiten mit Tandem-Thematikund Zugang zu PraktikumsplaumltzenOrientierung mit Hilfe des Forschungsregisters und Zugang zu unserer Materialsammlung(Praumlsenzbibliothek und Kopierservice)

Moumlglichkeit den Kongress Internationale TANDEM-Tage an der eigenen Einrichtung zu organisierenBeschleunigte Information uumlber Forschungs- und sonstige Grossprojekte Beratung und KontaktvermittlungKostenlose Zusendung des Newsletters TANDEM-Neuigkeiten dreimal jaumlhrlichfuumlr Mitglieder das Recht die Marke TANDEM und den Hinweis Mitglied derTandem-Stiftung zu fuumlhren fuumlr Lizenzinhaber Hinweis Eingetragener Verwender derTANDEM-Methode

Uumlber die konkreten Einzelleistungen hinaus bietet die Assoziation den Anschluss an ein Netzvon WissenschaftlerInnen und PraktikerInnen in derzeit 13 Laumlndern die einen grossenErfahrungspool zum Themenbereich Sprache-Kultur-Austausch bilden

Die Rechte und Pflichten sind in der Satzung genauer beschrieben

27N Mitglieder des StiftungsratsMitglieder des Stiftungsrats koumlnnen Einrichtungen werden die alle folgende Bedingungen erfuumlllena) Rechtsform als oumlffentliche Einrichtung oder gemeinnuumltziger Verein oder aumlhnliche die das WarenzeichenTANDEM nicht zur Werbung fuumlr Sprachkursverkauf verwenden In Laumlndern wo diese Rechtsform nichtbestehen koumlnnen vom Vorstand andere Formen zugelassen werdenb) ausreichende Garantien fuumlr die Stabilitaumlt der Einrichtungc) eine paumldagogische Linie die die Erweiterung oder Ersetzung der traditionellen LehrerInnenrolle durch dieVerwendung von Tandem-Verfahren kommunikationsfoumlrdernden Unterricht und einen interkulturellenAnsatz sowie die Anwesenheit verschiedener Kulturen in der Belegschaft umfasst

27a N LizenzenAn Einrichtungen die sich dem Sprachunterricht und dem interkulturellen Kontakt im Allgemeinen widmenund begruumlndetes Interesse an der Anwendung der Tandem-Methode haben koumlnnen Lizenzen zur Benutzungder Texte die zum Stiftungsvermoumlgen gehoumlren und des Warenzeichens TANDEM vergeben werden

31N Rechte der MitgliederDie Mitglieder haben das Rechta) alle Organe der Stiftung zu waumlhlen zu kontrollieren und abzuwaumlhlenb) sich fuumlr alle Organe zur Wahl zu stellenc) die Bezeichnung Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung zu verwendend) das urheberrechtlich geschuumltzte Material Nr 128568 und alles von Mitgliedern des Stiftungsrats fuumlrTandem-Aktivitaumlten erarbeitete Material zu verwendene)Tandem-Einzelvermittlung und damit verbundene Kurse durchzufuumlhrenf) an allen Projekten der Stiftung teilzunehmeng) ihre Erfahrungen zu veroumlffentlichen sofern dem nicht andere Bestimmungen dieser Satzungentgegenstehenh) von der Stiftung Aus- und Fortbildung zu guumlnstigeren Bedingungen als die Allgemeinheit zu erhalteni) dass alle ihre Angestellten an Sprachkursen von tandem International zu guumlnstigeren Bedingungen als dieAllgemeinheit teilnehmen

31b N Rechte der Lizenzinhaber Die Lizenzinhaber haben das Recht a) sich uumlber die Taumltigkeit des Vorstands zu informieren und mit Rede- und ohne Stimmrecht an denVersammlungen des Stiftungsrats teilzunehmenb) die Aufnahme in den Stiftungsrat zu beantragen wenn sie die Bedingungen erfuumlllenc) die Bezeichnung Eingetragener Verwender der Tandem-Methode sowie die in 31 d) e) f) g) h) i)genannten Rechte zu verwendenWeitere Rechte koumlnnen vertraglich festgelegt werden

32N Pflichten der Mitglieder

Die Mitglieder haben folgende Pflichtena) den Satz Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung und der Adressewwwtandemcityinfo in alle tandembezogene Werbung aufzunehmenb) nach dem Austritt keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt) entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode mit Angabe desNamens und der Sprechzeiten desr Tandemvermittlungs-Verantwortlichen der Einrichtung auszustellenh) Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen der Stiftung mitzuteileni) einen jaumlhrlichen Rundbrief uumlber Lage und Aktivitaumlten an alle Mitglieder zu uumlbersendenj) an den Vollversammlungen teilzunehmen und sie turnusmaumlssig zu organisierenk) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenu) dendie Tandemvermittlungs-Verantwortlichen durch den Einfuumlhrungskursden Fernkurs der Stiftungauszubildenv) die Ausbildungen spaumltestens alle fuumlnf Jahre durch den Praumlsenz- oder Fernkurs der Stiftung auf den neustenStand zu bringenw) die Kriterien fuumlr die Qualitaumlt der Vermittlung die die Stiftung entwickelt anzuwenden

32 b N Pflichten der LizenzinhaberDie Lizenzinhaber haben die Pflichta) die Bezeichnung Eingetragener Verwender der Tandem-Methode und die Adresse wwwtandemcityinfooder wwwtandemcitycom in alle tandembezogene Werbung aufzunehmenb) nach dem Ende der Lizenz keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode auszustellenh) der Stiftung Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen mitzuteileni) jaumlhrlich die von der Stiftung erbetenen statistischen Angaben uumlber den Einsatz der Tandem-Methode zuschicken(j) entfaumlllt) k) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)

o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenWeitere Pflichten koumlnnen vertraglich festgelegt werden

3 ENGLISH

Dear Colleagues

You are interested in the membership in Tandem Foundation created for universities and similar learning insti-tutions which dont offer language courses open to the general public but which wouldlike to implement within the institution itself or in exchange programs the Tandemsystemor a licence of use of Tandem material offer for any institution or school with a justifiedinterest in the application of tandem method in linguistic and cultural exchangesor you as a language school for foreigners wish to become member of the associationTandem International which includes a licence of use of Tandem material

Both membership status or licences offer the following advantages

1 Use of the material developed by the Tandem Network without paying royalties to theauthors eg the series of articles contained in the Self Access Tandem introductionPacket 2 Suggestions for Tandem Partners who practice the languages of Albanian ArabicBasque Bulgarian Czech Danish English French German Hungarian Italian LetonianPolish Portuguese Serbocroat Slovenian Spanish and Turkish (photocopied materialandor diskettes) 3 Suggestions for text comprehension by professional Tandem-partners in BasqueCzech English French German Italian Portuguese Slovenian and Spanish (photocopiedmaterial andor diskettes) 4 Free reception of all recent publications of Foundation eg books and CDs aboutmultilingual Babylonia-Tandem and cross-border Mugaz Gain 5 Participation in Foundation training seminars for two thirds of the regular price andthe option of jointly organising said courses 6 Participation of all employees (including those who have been contracted on an hourlybasis) in the language courses of the approximately 25 TANDEM International schoolsthroughout the world with discount now of a 20 7 Collaboration with university students and doctoral candidates who are working withthe subject of Tandem as well as providing them with access to professional trainingpositions 8 Professional orientation by means of the research register and access to our material(library and long distance photocopying service) 9 The possibility of organising the Tandem International Conference at ones own school 10 Free subscription to the TANDEM-Neuigkeiten bulletin which is publishedthree times a year 11 Rapid information about our research as well as other projects consultancyand service for making contacts

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

Sugerencias para la comprensioacuten de textos para Parejas Tandem profesionales enalemaacuten castellano checo esloveno franceacutes ingleacutes italiano portugueacutes y vasco (fotoco-pias yo disquetes) Recepcioacuten gratuita de las uacuteltimas publicaciones de cada momento por ejemplo libros yCDs sobre el Babylonia-Tandem multilinguumle o el programa transfronterizo Mugaz GainParticipacioacuten en seminarios de formacioacuten de la Fundacioacuten por dos tercios del precio y

opcioacuten a la organizacioacuten conjunta de tales cursos Participacioacuten de tods ls empleads (incluidos contratads por horas) en los cursos de idiomas de las aprox 25 escuelas de TANDEM International en todo el mundo con undescuento actualmente del 20 Atencioacuten a estudiantes universitaris y de doctorado que trabajen con el tema Tandem y acceso a plazas de praacutecticasOrientacioacuten por medio de registros de investigacioacuten y acceso a nuestro material (biblioteca) servicio de fotocopias a distanciaPosibilidad de organizar el Congreso Jornadas Internacionales Tandem en su propia institucioacutenEnviacuteo gratuito del boletiacuten TANDEM-Neuigkeiten tres veces al antildeoInformacioacuten raacutepida sobre nuestros proyectos de investigacioacuten u otros asesoriacutea y bolsa de contactosPara miembros derecho al uso del logotipo TANDEM y a la mencioacuten del estatusrdquoMiembro de la Fundacioacuten Tandemrdquo para licenciatarios mencioacuten del estatus Usuarioregistrado del meacutetodo TANDEM

Aparte de los servicios concretos la asociacioacuten o licencia ofrece conexioacuten con una red decientiacutefics y profesoresas por el momento en trece paises que cuentan con gran experienciaen el aacuterea de intercambio cultural y de idiomas

Los derechos y deberes se describen maacutes exactamente en los Estatutos

27N Miembros del PatronatoPodraacuten admitirse como miembros entidades que cumplan con los siguientes requisitosa) forma legal como institucioacuten puacuteblica asociacioacuten de utilidad puacuteblica y similares que no usen la marcalsquoTANDEMrsquo para publicidad para vender cursos de idiomas La Junta Directiva de la Fundacioacuten podraacute admitirotras formas para paiacuteses donde no existen estas formas legalesb) existir las suficientes garantiacuteas de estabilidad de la entidad c) una linea pedagoacutegica que incluya la ampliacioacuten o sustitucioacuten del papel tradicional del profesorado por elmeacutetodo taacutendem y ensentildeanza comunicativa un enfoque intercultural y la presencia de diferentes culturas entreel personal

27a N LicenciasPodraacuten otorgarse licencias del uso de los textos que forman parte del patrimonio fundacional y de la marcaTANDEM a entidades dedicadas a la ensentildeanza de idiomas y al contacto intercultural en general que tenganintereacutes fundamentado en la aplicacioacuten del meacutetodo taacutendem

31N Derechos de los miembrosLos miembros tendraacuten el derecho dea) participar en las Asambleas Generales con voz y voto y elegir controlar y destituir todos los oacuterganos de laFundacioacutenb) presentarse a eleccioacuten para todos los oacuterganos de la Fundacioacutenc) usar la denominacioacuten Usuario reconocido del meacutetodo TANDEM con el logotipo de la Fundacioacuten

d) usar el material protegido por el registro ante el Registro de Propiedad Intelectual de Madrid nuacutemero128568 y todo el material para actividades taacutendem elaborado por miembros del Patronatoe) realizar intermediacioacuten individual taacutendem y cursos combinados con ellaf) participar en todos los proyectos de la Fundacioacuten g) publicar sus experiencias a no ser que lo impidan otras disposiciones de estos estatutosh) recibir formacioacuten de la Fundacioacuten en condiciones maacutes favorables que el puacuteblico en generali) que todosas sus empleadosas participen en cursos de idiomas de tandem International en condiciones maacutesfavorables que el puacuteblico en general

31 b N Derechos de los licenciatarios Los licenciatarios tendraacuten el derecho dea) informarse sobre la gestioacuten de la Junta Directiva y asistir con voz sin voto a las asambleas del Patronatob) solicitar el paso a ser miembrorsquo cuando cumplan con los requisitosc) usar la denominacioacuten Usuario registrado del meacutetodo TANDEMasi como los derechos mencionados en 31 d) e) f) g) h) i)Se pueden definir derechos adicionales por contrato

32N Deberes de los miembrosLos miembros tendraacuten el deber dea) poner la frase usuario reconocido del meacutetodo TANDEM con el logotipo de la Fundacioacuten y la direccioacutenwwwtandemcityinfo en toda su publicidad referida al meacutetodo taacutendemb) no realizar actividades taacutendem seguacuten artiacuteculo 7 despueacutes de darse de baja del Patronatoc) informar al departamento defensa de la marca TANDEM de la Fundacioacuten sobre infracciones en su ambitode actuacioacutend) pagar las aportacionese) respetar el tope maacuteximo que se cobraraacute por una intermediacioacuten taacutendem fijado anualmente por el Patronatof) enviar un ejemplar de cada publicacioacuten referente a la metodologiacutea taacutendem y de sus folletos gratuitamente ala Fundacioacuteng) exponer de forma permanente un cartel facilitado por la Fundacioacuten sobre el meacutetodo taacutendem con indicacioacutendela responsable de intermediaciones taacutendem de la entidad y su horarioh) comunicar nombre y direccioacuten electroacutenica de su responsable de intermediacioacuten a la Fundacioacuteni) enviar una circular anual sobre su situacioacuten y actividades a todos los miembros del Patronatoj) participar en las Asambleas del Patronato y organizarlask) como proteccioacuten ante plagios antildeadir el siacutembolo reg o detraacutes de TANDEM o insertar una nota a pieacute depaacutegina en textos cientiacuteficosl) exponer la publicidad de los demaacutes miembros y licenciatarios en su sede y mencionar la Fundacioacuten en suspublicaciones referidas a taacutendem como interlocutora para entidades interesadas en hacerse miembro delPatronato o licenciatariom) antes de iniciar actividades en una ciudad donde haya otro miembro o licenciatario informarlon) (fundido con m)o) comunicar a la Fundacioacuten entidades que puedan ser miembros o licenciatarios potencialessuprimido (p) q) r) no intentar registrar la marca TANDEM por si sola o combinada para la propia entidads) no tener participaciones en empresas que infrinjan estos deberes(t) suprimidou) formar alla responsable de intermediaciones taacutendem por el curso presencial o a distancia de la Fundacioacutenv) actualizar la formaciones al menos cada 5 antildeos por curso presencial o a distancia de la Fundacioacutenw) aplicar los criterios de calidad de la intermediacioacuten taacutendem que desarrolle la Fundacioacuten

32 b N Deberes de los licenciatariosLos licenciatarios tendraacuten el deber dea) poner la frase Usuario registrado del meacutetodo TANDEM y la direccioacuten wwwtandemcityinfo owwwtandemcitycom en toda su publicidad referida al meacutetodo taacutendemb) no realizar actividades taacutendem seguacuten artiacuteculo 7 despueacutes de darse de baja del Patronatoc) informar a la Fundacioacuten sobre infracciones en su ambito de actuacioacutend) pagar las aportacionese) respetar el tope maacuteximo que se cobraraacute por una intermediacioacuten taacutendem fijado anualmente por el Patronato(f) suprimido)g) enviar un ejemplar de cada publicacioacuten referente a la metodologiacutea taacutendem y de sus folletos gratuitamente ala Fundacioacuten

h) exponer de forma permanente un cartel facilitado por la Fundacioacuten sobre el meacutetodo taacutendemi) comunicar nombre y direccioacuten electroacutenica de su responsable de intermediacioacuten taacutendem a la Fundacioacutenj) facilitar anualmente los datos estadiacutesticos sobre el uso del meacutetodo taacutendem que requiera la Fundacioacutenk) como proteccioacuten ante plagios antildeadir el siacutembolo reg o detraacutes de TANDEM o insertar una nota a pieacute depaacutegina en textos cientiacuteficosl) exponer la publicidad de los demaacutes miembros en su sede y mencionar la Fundacioacuten en sus publicacionesreferidas a taacutendem como interlocutora para entidades interesadas en hacerse miembro del Patronato olicenciatariom) antes de iniciar actividades en una ciudad donde haya otro miembro o licenciatario informarlor) no intentar registrar la marca TANDEM por si sola o combinada para la propia entidads) no tener participaciones en empresas que infrinjan estos deberesSe pueden definir deberes adicionales por contrato

2 DEUTSCH

LiebeR KollegIn

Sie interessieren sich fuumlr die Mitgliedschaft Ihrer Einrichtung in der Tandem-Stiftung Dieser Status wurde fuumlrUniversitaumlten und aumlhnliche oumlffentliche oder vergleichbare Einrichtungen geschaffen diekeine Sprachkurse auf dem freien Markt anbieten aber Tandem intern und inAustauschprojekten verwenden moumlchtenoder eine Lizenz zur Verwendung der Tandem-Methode das Angebot fuumlr alleEinrichtungen oder Schulen die ein begruumlndetes Interesse an der Anwendung derTandem-Methode in Sprach- und Kulturaustauschprogrammen habenoder Sie moumlchten als Sprachschule fuumlr AuslaumlnderInnen Mitglied des Vereins TandemInternational werden und das schliesst die Lizenz zur Verwendung der Tandem-Methodemit ein

Sowohl die Mitgliedschaft als auch die Lizenz bieten folgende Vorteile

Benutzung des im TANDEM-Netz entwickelten Materials ohne CopyrightvorbehaltzB die im Selbstlernkurs zur Einfuumlhrung in Tandem enthaltenen ArtikelTipps fuumlr Einzeltandems auf albanisch arabisch baskisch bulgarisch daumlnisch deutschenglisch franzoumlsisch italienisch lettisch polnisch portugiesisch serbokroatischslowenisch spanisch tschechisch ungarisch tuumlrkisch (Fotokopiervorlagen undoderDisketten)Tipps zum Leseverstehen fuumlr Fachtandems auf baskisch deutsch englisch franzoumlsischitalienisch portugiesisch slowenisch spanisch tschechisch (Fotokopiervorlagen undoderDisketten)die jeweils neusten Veroumlffentlichungen (Buumlcher und CDs) zB zum Babylonia-Tandemund grenzuumlberschreitenden Mugaz Gain-Tandem kostenlosTeilnahme an den Fortbildungsveranstaltungen der Stiftung zum 23-Preis und Moumlglichkeitzur gemeinsamen Veranstaltung von FortbildungskursenTeilnahme aller Angestellten (auch Honorarkraumlfte) an allen Sprachkursen an den rund 25 Tandemschulen auf der ganzen Welt mit Rabatt derzeit von 20 Betreuung von DiplomandInnen und DoktorandInnen bei Arbeiten mit Tandem-Thematikund Zugang zu PraktikumsplaumltzenOrientierung mit Hilfe des Forschungsregisters und Zugang zu unserer Materialsammlung(Praumlsenzbibliothek und Kopierservice)

Moumlglichkeit den Kongress Internationale TANDEM-Tage an der eigenen Einrichtung zu organisierenBeschleunigte Information uumlber Forschungs- und sonstige Grossprojekte Beratung und KontaktvermittlungKostenlose Zusendung des Newsletters TANDEM-Neuigkeiten dreimal jaumlhrlichfuumlr Mitglieder das Recht die Marke TANDEM und den Hinweis Mitglied derTandem-Stiftung zu fuumlhren fuumlr Lizenzinhaber Hinweis Eingetragener Verwender derTANDEM-Methode

Uumlber die konkreten Einzelleistungen hinaus bietet die Assoziation den Anschluss an ein Netzvon WissenschaftlerInnen und PraktikerInnen in derzeit 13 Laumlndern die einen grossenErfahrungspool zum Themenbereich Sprache-Kultur-Austausch bilden

Die Rechte und Pflichten sind in der Satzung genauer beschrieben

27N Mitglieder des StiftungsratsMitglieder des Stiftungsrats koumlnnen Einrichtungen werden die alle folgende Bedingungen erfuumlllena) Rechtsform als oumlffentliche Einrichtung oder gemeinnuumltziger Verein oder aumlhnliche die das WarenzeichenTANDEM nicht zur Werbung fuumlr Sprachkursverkauf verwenden In Laumlndern wo diese Rechtsform nichtbestehen koumlnnen vom Vorstand andere Formen zugelassen werdenb) ausreichende Garantien fuumlr die Stabilitaumlt der Einrichtungc) eine paumldagogische Linie die die Erweiterung oder Ersetzung der traditionellen LehrerInnenrolle durch dieVerwendung von Tandem-Verfahren kommunikationsfoumlrdernden Unterricht und einen interkulturellenAnsatz sowie die Anwesenheit verschiedener Kulturen in der Belegschaft umfasst

27a N LizenzenAn Einrichtungen die sich dem Sprachunterricht und dem interkulturellen Kontakt im Allgemeinen widmenund begruumlndetes Interesse an der Anwendung der Tandem-Methode haben koumlnnen Lizenzen zur Benutzungder Texte die zum Stiftungsvermoumlgen gehoumlren und des Warenzeichens TANDEM vergeben werden

31N Rechte der MitgliederDie Mitglieder haben das Rechta) alle Organe der Stiftung zu waumlhlen zu kontrollieren und abzuwaumlhlenb) sich fuumlr alle Organe zur Wahl zu stellenc) die Bezeichnung Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung zu verwendend) das urheberrechtlich geschuumltzte Material Nr 128568 und alles von Mitgliedern des Stiftungsrats fuumlrTandem-Aktivitaumlten erarbeitete Material zu verwendene)Tandem-Einzelvermittlung und damit verbundene Kurse durchzufuumlhrenf) an allen Projekten der Stiftung teilzunehmeng) ihre Erfahrungen zu veroumlffentlichen sofern dem nicht andere Bestimmungen dieser Satzungentgegenstehenh) von der Stiftung Aus- und Fortbildung zu guumlnstigeren Bedingungen als die Allgemeinheit zu erhalteni) dass alle ihre Angestellten an Sprachkursen von tandem International zu guumlnstigeren Bedingungen als dieAllgemeinheit teilnehmen

31b N Rechte der Lizenzinhaber Die Lizenzinhaber haben das Recht a) sich uumlber die Taumltigkeit des Vorstands zu informieren und mit Rede- und ohne Stimmrecht an denVersammlungen des Stiftungsrats teilzunehmenb) die Aufnahme in den Stiftungsrat zu beantragen wenn sie die Bedingungen erfuumlllenc) die Bezeichnung Eingetragener Verwender der Tandem-Methode sowie die in 31 d) e) f) g) h) i)genannten Rechte zu verwendenWeitere Rechte koumlnnen vertraglich festgelegt werden

32N Pflichten der Mitglieder

Die Mitglieder haben folgende Pflichtena) den Satz Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung und der Adressewwwtandemcityinfo in alle tandembezogene Werbung aufzunehmenb) nach dem Austritt keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt) entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode mit Angabe desNamens und der Sprechzeiten desr Tandemvermittlungs-Verantwortlichen der Einrichtung auszustellenh) Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen der Stiftung mitzuteileni) einen jaumlhrlichen Rundbrief uumlber Lage und Aktivitaumlten an alle Mitglieder zu uumlbersendenj) an den Vollversammlungen teilzunehmen und sie turnusmaumlssig zu organisierenk) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenu) dendie Tandemvermittlungs-Verantwortlichen durch den Einfuumlhrungskursden Fernkurs der Stiftungauszubildenv) die Ausbildungen spaumltestens alle fuumlnf Jahre durch den Praumlsenz- oder Fernkurs der Stiftung auf den neustenStand zu bringenw) die Kriterien fuumlr die Qualitaumlt der Vermittlung die die Stiftung entwickelt anzuwenden

32 b N Pflichten der LizenzinhaberDie Lizenzinhaber haben die Pflichta) die Bezeichnung Eingetragener Verwender der Tandem-Methode und die Adresse wwwtandemcityinfooder wwwtandemcitycom in alle tandembezogene Werbung aufzunehmenb) nach dem Ende der Lizenz keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode auszustellenh) der Stiftung Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen mitzuteileni) jaumlhrlich die von der Stiftung erbetenen statistischen Angaben uumlber den Einsatz der Tandem-Methode zuschicken(j) entfaumlllt) k) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)

o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenWeitere Pflichten koumlnnen vertraglich festgelegt werden

3 ENGLISH

Dear Colleagues

You are interested in the membership in Tandem Foundation created for universities and similar learning insti-tutions which dont offer language courses open to the general public but which wouldlike to implement within the institution itself or in exchange programs the Tandemsystemor a licence of use of Tandem material offer for any institution or school with a justifiedinterest in the application of tandem method in linguistic and cultural exchangesor you as a language school for foreigners wish to become member of the associationTandem International which includes a licence of use of Tandem material

Both membership status or licences offer the following advantages

1 Use of the material developed by the Tandem Network without paying royalties to theauthors eg the series of articles contained in the Self Access Tandem introductionPacket 2 Suggestions for Tandem Partners who practice the languages of Albanian ArabicBasque Bulgarian Czech Danish English French German Hungarian Italian LetonianPolish Portuguese Serbocroat Slovenian Spanish and Turkish (photocopied materialandor diskettes) 3 Suggestions for text comprehension by professional Tandem-partners in BasqueCzech English French German Italian Portuguese Slovenian and Spanish (photocopiedmaterial andor diskettes) 4 Free reception of all recent publications of Foundation eg books and CDs aboutmultilingual Babylonia-Tandem and cross-border Mugaz Gain 5 Participation in Foundation training seminars for two thirds of the regular price andthe option of jointly organising said courses 6 Participation of all employees (including those who have been contracted on an hourlybasis) in the language courses of the approximately 25 TANDEM International schoolsthroughout the world with discount now of a 20 7 Collaboration with university students and doctoral candidates who are working withthe subject of Tandem as well as providing them with access to professional trainingpositions 8 Professional orientation by means of the research register and access to our material(library and long distance photocopying service) 9 The possibility of organising the Tandem International Conference at ones own school 10 Free subscription to the TANDEM-Neuigkeiten bulletin which is publishedthree times a year 11 Rapid information about our research as well as other projects consultancyand service for making contacts

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

d) usar el material protegido por el registro ante el Registro de Propiedad Intelectual de Madrid nuacutemero128568 y todo el material para actividades taacutendem elaborado por miembros del Patronatoe) realizar intermediacioacuten individual taacutendem y cursos combinados con ellaf) participar en todos los proyectos de la Fundacioacuten g) publicar sus experiencias a no ser que lo impidan otras disposiciones de estos estatutosh) recibir formacioacuten de la Fundacioacuten en condiciones maacutes favorables que el puacuteblico en generali) que todosas sus empleadosas participen en cursos de idiomas de tandem International en condiciones maacutesfavorables que el puacuteblico en general

31 b N Derechos de los licenciatarios Los licenciatarios tendraacuten el derecho dea) informarse sobre la gestioacuten de la Junta Directiva y asistir con voz sin voto a las asambleas del Patronatob) solicitar el paso a ser miembrorsquo cuando cumplan con los requisitosc) usar la denominacioacuten Usuario registrado del meacutetodo TANDEMasi como los derechos mencionados en 31 d) e) f) g) h) i)Se pueden definir derechos adicionales por contrato

32N Deberes de los miembrosLos miembros tendraacuten el deber dea) poner la frase usuario reconocido del meacutetodo TANDEM con el logotipo de la Fundacioacuten y la direccioacutenwwwtandemcityinfo en toda su publicidad referida al meacutetodo taacutendemb) no realizar actividades taacutendem seguacuten artiacuteculo 7 despueacutes de darse de baja del Patronatoc) informar al departamento defensa de la marca TANDEM de la Fundacioacuten sobre infracciones en su ambitode actuacioacutend) pagar las aportacionese) respetar el tope maacuteximo que se cobraraacute por una intermediacioacuten taacutendem fijado anualmente por el Patronatof) enviar un ejemplar de cada publicacioacuten referente a la metodologiacutea taacutendem y de sus folletos gratuitamente ala Fundacioacuteng) exponer de forma permanente un cartel facilitado por la Fundacioacuten sobre el meacutetodo taacutendem con indicacioacutendela responsable de intermediaciones taacutendem de la entidad y su horarioh) comunicar nombre y direccioacuten electroacutenica de su responsable de intermediacioacuten a la Fundacioacuteni) enviar una circular anual sobre su situacioacuten y actividades a todos los miembros del Patronatoj) participar en las Asambleas del Patronato y organizarlask) como proteccioacuten ante plagios antildeadir el siacutembolo reg o detraacutes de TANDEM o insertar una nota a pieacute depaacutegina en textos cientiacuteficosl) exponer la publicidad de los demaacutes miembros y licenciatarios en su sede y mencionar la Fundacioacuten en suspublicaciones referidas a taacutendem como interlocutora para entidades interesadas en hacerse miembro delPatronato o licenciatariom) antes de iniciar actividades en una ciudad donde haya otro miembro o licenciatario informarlon) (fundido con m)o) comunicar a la Fundacioacuten entidades que puedan ser miembros o licenciatarios potencialessuprimido (p) q) r) no intentar registrar la marca TANDEM por si sola o combinada para la propia entidads) no tener participaciones en empresas que infrinjan estos deberes(t) suprimidou) formar alla responsable de intermediaciones taacutendem por el curso presencial o a distancia de la Fundacioacutenv) actualizar la formaciones al menos cada 5 antildeos por curso presencial o a distancia de la Fundacioacutenw) aplicar los criterios de calidad de la intermediacioacuten taacutendem que desarrolle la Fundacioacuten

32 b N Deberes de los licenciatariosLos licenciatarios tendraacuten el deber dea) poner la frase Usuario registrado del meacutetodo TANDEM y la direccioacuten wwwtandemcityinfo owwwtandemcitycom en toda su publicidad referida al meacutetodo taacutendemb) no realizar actividades taacutendem seguacuten artiacuteculo 7 despueacutes de darse de baja del Patronatoc) informar a la Fundacioacuten sobre infracciones en su ambito de actuacioacutend) pagar las aportacionese) respetar el tope maacuteximo que se cobraraacute por una intermediacioacuten taacutendem fijado anualmente por el Patronato(f) suprimido)g) enviar un ejemplar de cada publicacioacuten referente a la metodologiacutea taacutendem y de sus folletos gratuitamente ala Fundacioacuten

h) exponer de forma permanente un cartel facilitado por la Fundacioacuten sobre el meacutetodo taacutendemi) comunicar nombre y direccioacuten electroacutenica de su responsable de intermediacioacuten taacutendem a la Fundacioacutenj) facilitar anualmente los datos estadiacutesticos sobre el uso del meacutetodo taacutendem que requiera la Fundacioacutenk) como proteccioacuten ante plagios antildeadir el siacutembolo reg o detraacutes de TANDEM o insertar una nota a pieacute depaacutegina en textos cientiacuteficosl) exponer la publicidad de los demaacutes miembros en su sede y mencionar la Fundacioacuten en sus publicacionesreferidas a taacutendem como interlocutora para entidades interesadas en hacerse miembro del Patronato olicenciatariom) antes de iniciar actividades en una ciudad donde haya otro miembro o licenciatario informarlor) no intentar registrar la marca TANDEM por si sola o combinada para la propia entidads) no tener participaciones en empresas que infrinjan estos deberesSe pueden definir deberes adicionales por contrato

2 DEUTSCH

LiebeR KollegIn

Sie interessieren sich fuumlr die Mitgliedschaft Ihrer Einrichtung in der Tandem-Stiftung Dieser Status wurde fuumlrUniversitaumlten und aumlhnliche oumlffentliche oder vergleichbare Einrichtungen geschaffen diekeine Sprachkurse auf dem freien Markt anbieten aber Tandem intern und inAustauschprojekten verwenden moumlchtenoder eine Lizenz zur Verwendung der Tandem-Methode das Angebot fuumlr alleEinrichtungen oder Schulen die ein begruumlndetes Interesse an der Anwendung derTandem-Methode in Sprach- und Kulturaustauschprogrammen habenoder Sie moumlchten als Sprachschule fuumlr AuslaumlnderInnen Mitglied des Vereins TandemInternational werden und das schliesst die Lizenz zur Verwendung der Tandem-Methodemit ein

Sowohl die Mitgliedschaft als auch die Lizenz bieten folgende Vorteile

Benutzung des im TANDEM-Netz entwickelten Materials ohne CopyrightvorbehaltzB die im Selbstlernkurs zur Einfuumlhrung in Tandem enthaltenen ArtikelTipps fuumlr Einzeltandems auf albanisch arabisch baskisch bulgarisch daumlnisch deutschenglisch franzoumlsisch italienisch lettisch polnisch portugiesisch serbokroatischslowenisch spanisch tschechisch ungarisch tuumlrkisch (Fotokopiervorlagen undoderDisketten)Tipps zum Leseverstehen fuumlr Fachtandems auf baskisch deutsch englisch franzoumlsischitalienisch portugiesisch slowenisch spanisch tschechisch (Fotokopiervorlagen undoderDisketten)die jeweils neusten Veroumlffentlichungen (Buumlcher und CDs) zB zum Babylonia-Tandemund grenzuumlberschreitenden Mugaz Gain-Tandem kostenlosTeilnahme an den Fortbildungsveranstaltungen der Stiftung zum 23-Preis und Moumlglichkeitzur gemeinsamen Veranstaltung von FortbildungskursenTeilnahme aller Angestellten (auch Honorarkraumlfte) an allen Sprachkursen an den rund 25 Tandemschulen auf der ganzen Welt mit Rabatt derzeit von 20 Betreuung von DiplomandInnen und DoktorandInnen bei Arbeiten mit Tandem-Thematikund Zugang zu PraktikumsplaumltzenOrientierung mit Hilfe des Forschungsregisters und Zugang zu unserer Materialsammlung(Praumlsenzbibliothek und Kopierservice)

Moumlglichkeit den Kongress Internationale TANDEM-Tage an der eigenen Einrichtung zu organisierenBeschleunigte Information uumlber Forschungs- und sonstige Grossprojekte Beratung und KontaktvermittlungKostenlose Zusendung des Newsletters TANDEM-Neuigkeiten dreimal jaumlhrlichfuumlr Mitglieder das Recht die Marke TANDEM und den Hinweis Mitglied derTandem-Stiftung zu fuumlhren fuumlr Lizenzinhaber Hinweis Eingetragener Verwender derTANDEM-Methode

Uumlber die konkreten Einzelleistungen hinaus bietet die Assoziation den Anschluss an ein Netzvon WissenschaftlerInnen und PraktikerInnen in derzeit 13 Laumlndern die einen grossenErfahrungspool zum Themenbereich Sprache-Kultur-Austausch bilden

Die Rechte und Pflichten sind in der Satzung genauer beschrieben

27N Mitglieder des StiftungsratsMitglieder des Stiftungsrats koumlnnen Einrichtungen werden die alle folgende Bedingungen erfuumlllena) Rechtsform als oumlffentliche Einrichtung oder gemeinnuumltziger Verein oder aumlhnliche die das WarenzeichenTANDEM nicht zur Werbung fuumlr Sprachkursverkauf verwenden In Laumlndern wo diese Rechtsform nichtbestehen koumlnnen vom Vorstand andere Formen zugelassen werdenb) ausreichende Garantien fuumlr die Stabilitaumlt der Einrichtungc) eine paumldagogische Linie die die Erweiterung oder Ersetzung der traditionellen LehrerInnenrolle durch dieVerwendung von Tandem-Verfahren kommunikationsfoumlrdernden Unterricht und einen interkulturellenAnsatz sowie die Anwesenheit verschiedener Kulturen in der Belegschaft umfasst

27a N LizenzenAn Einrichtungen die sich dem Sprachunterricht und dem interkulturellen Kontakt im Allgemeinen widmenund begruumlndetes Interesse an der Anwendung der Tandem-Methode haben koumlnnen Lizenzen zur Benutzungder Texte die zum Stiftungsvermoumlgen gehoumlren und des Warenzeichens TANDEM vergeben werden

31N Rechte der MitgliederDie Mitglieder haben das Rechta) alle Organe der Stiftung zu waumlhlen zu kontrollieren und abzuwaumlhlenb) sich fuumlr alle Organe zur Wahl zu stellenc) die Bezeichnung Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung zu verwendend) das urheberrechtlich geschuumltzte Material Nr 128568 und alles von Mitgliedern des Stiftungsrats fuumlrTandem-Aktivitaumlten erarbeitete Material zu verwendene)Tandem-Einzelvermittlung und damit verbundene Kurse durchzufuumlhrenf) an allen Projekten der Stiftung teilzunehmeng) ihre Erfahrungen zu veroumlffentlichen sofern dem nicht andere Bestimmungen dieser Satzungentgegenstehenh) von der Stiftung Aus- und Fortbildung zu guumlnstigeren Bedingungen als die Allgemeinheit zu erhalteni) dass alle ihre Angestellten an Sprachkursen von tandem International zu guumlnstigeren Bedingungen als dieAllgemeinheit teilnehmen

31b N Rechte der Lizenzinhaber Die Lizenzinhaber haben das Recht a) sich uumlber die Taumltigkeit des Vorstands zu informieren und mit Rede- und ohne Stimmrecht an denVersammlungen des Stiftungsrats teilzunehmenb) die Aufnahme in den Stiftungsrat zu beantragen wenn sie die Bedingungen erfuumlllenc) die Bezeichnung Eingetragener Verwender der Tandem-Methode sowie die in 31 d) e) f) g) h) i)genannten Rechte zu verwendenWeitere Rechte koumlnnen vertraglich festgelegt werden

32N Pflichten der Mitglieder

Die Mitglieder haben folgende Pflichtena) den Satz Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung und der Adressewwwtandemcityinfo in alle tandembezogene Werbung aufzunehmenb) nach dem Austritt keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt) entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode mit Angabe desNamens und der Sprechzeiten desr Tandemvermittlungs-Verantwortlichen der Einrichtung auszustellenh) Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen der Stiftung mitzuteileni) einen jaumlhrlichen Rundbrief uumlber Lage und Aktivitaumlten an alle Mitglieder zu uumlbersendenj) an den Vollversammlungen teilzunehmen und sie turnusmaumlssig zu organisierenk) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenu) dendie Tandemvermittlungs-Verantwortlichen durch den Einfuumlhrungskursden Fernkurs der Stiftungauszubildenv) die Ausbildungen spaumltestens alle fuumlnf Jahre durch den Praumlsenz- oder Fernkurs der Stiftung auf den neustenStand zu bringenw) die Kriterien fuumlr die Qualitaumlt der Vermittlung die die Stiftung entwickelt anzuwenden

32 b N Pflichten der LizenzinhaberDie Lizenzinhaber haben die Pflichta) die Bezeichnung Eingetragener Verwender der Tandem-Methode und die Adresse wwwtandemcityinfooder wwwtandemcitycom in alle tandembezogene Werbung aufzunehmenb) nach dem Ende der Lizenz keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode auszustellenh) der Stiftung Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen mitzuteileni) jaumlhrlich die von der Stiftung erbetenen statistischen Angaben uumlber den Einsatz der Tandem-Methode zuschicken(j) entfaumlllt) k) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)

o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenWeitere Pflichten koumlnnen vertraglich festgelegt werden

3 ENGLISH

Dear Colleagues

You are interested in the membership in Tandem Foundation created for universities and similar learning insti-tutions which dont offer language courses open to the general public but which wouldlike to implement within the institution itself or in exchange programs the Tandemsystemor a licence of use of Tandem material offer for any institution or school with a justifiedinterest in the application of tandem method in linguistic and cultural exchangesor you as a language school for foreigners wish to become member of the associationTandem International which includes a licence of use of Tandem material

Both membership status or licences offer the following advantages

1 Use of the material developed by the Tandem Network without paying royalties to theauthors eg the series of articles contained in the Self Access Tandem introductionPacket 2 Suggestions for Tandem Partners who practice the languages of Albanian ArabicBasque Bulgarian Czech Danish English French German Hungarian Italian LetonianPolish Portuguese Serbocroat Slovenian Spanish and Turkish (photocopied materialandor diskettes) 3 Suggestions for text comprehension by professional Tandem-partners in BasqueCzech English French German Italian Portuguese Slovenian and Spanish (photocopiedmaterial andor diskettes) 4 Free reception of all recent publications of Foundation eg books and CDs aboutmultilingual Babylonia-Tandem and cross-border Mugaz Gain 5 Participation in Foundation training seminars for two thirds of the regular price andthe option of jointly organising said courses 6 Participation of all employees (including those who have been contracted on an hourlybasis) in the language courses of the approximately 25 TANDEM International schoolsthroughout the world with discount now of a 20 7 Collaboration with university students and doctoral candidates who are working withthe subject of Tandem as well as providing them with access to professional trainingpositions 8 Professional orientation by means of the research register and access to our material(library and long distance photocopying service) 9 The possibility of organising the Tandem International Conference at ones own school 10 Free subscription to the TANDEM-Neuigkeiten bulletin which is publishedthree times a year 11 Rapid information about our research as well as other projects consultancyand service for making contacts

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

h) exponer de forma permanente un cartel facilitado por la Fundacioacuten sobre el meacutetodo taacutendemi) comunicar nombre y direccioacuten electroacutenica de su responsable de intermediacioacuten taacutendem a la Fundacioacutenj) facilitar anualmente los datos estadiacutesticos sobre el uso del meacutetodo taacutendem que requiera la Fundacioacutenk) como proteccioacuten ante plagios antildeadir el siacutembolo reg o detraacutes de TANDEM o insertar una nota a pieacute depaacutegina en textos cientiacuteficosl) exponer la publicidad de los demaacutes miembros en su sede y mencionar la Fundacioacuten en sus publicacionesreferidas a taacutendem como interlocutora para entidades interesadas en hacerse miembro del Patronato olicenciatariom) antes de iniciar actividades en una ciudad donde haya otro miembro o licenciatario informarlor) no intentar registrar la marca TANDEM por si sola o combinada para la propia entidads) no tener participaciones en empresas que infrinjan estos deberesSe pueden definir deberes adicionales por contrato

2 DEUTSCH

LiebeR KollegIn

Sie interessieren sich fuumlr die Mitgliedschaft Ihrer Einrichtung in der Tandem-Stiftung Dieser Status wurde fuumlrUniversitaumlten und aumlhnliche oumlffentliche oder vergleichbare Einrichtungen geschaffen diekeine Sprachkurse auf dem freien Markt anbieten aber Tandem intern und inAustauschprojekten verwenden moumlchtenoder eine Lizenz zur Verwendung der Tandem-Methode das Angebot fuumlr alleEinrichtungen oder Schulen die ein begruumlndetes Interesse an der Anwendung derTandem-Methode in Sprach- und Kulturaustauschprogrammen habenoder Sie moumlchten als Sprachschule fuumlr AuslaumlnderInnen Mitglied des Vereins TandemInternational werden und das schliesst die Lizenz zur Verwendung der Tandem-Methodemit ein

Sowohl die Mitgliedschaft als auch die Lizenz bieten folgende Vorteile

Benutzung des im TANDEM-Netz entwickelten Materials ohne CopyrightvorbehaltzB die im Selbstlernkurs zur Einfuumlhrung in Tandem enthaltenen ArtikelTipps fuumlr Einzeltandems auf albanisch arabisch baskisch bulgarisch daumlnisch deutschenglisch franzoumlsisch italienisch lettisch polnisch portugiesisch serbokroatischslowenisch spanisch tschechisch ungarisch tuumlrkisch (Fotokopiervorlagen undoderDisketten)Tipps zum Leseverstehen fuumlr Fachtandems auf baskisch deutsch englisch franzoumlsischitalienisch portugiesisch slowenisch spanisch tschechisch (Fotokopiervorlagen undoderDisketten)die jeweils neusten Veroumlffentlichungen (Buumlcher und CDs) zB zum Babylonia-Tandemund grenzuumlberschreitenden Mugaz Gain-Tandem kostenlosTeilnahme an den Fortbildungsveranstaltungen der Stiftung zum 23-Preis und Moumlglichkeitzur gemeinsamen Veranstaltung von FortbildungskursenTeilnahme aller Angestellten (auch Honorarkraumlfte) an allen Sprachkursen an den rund 25 Tandemschulen auf der ganzen Welt mit Rabatt derzeit von 20 Betreuung von DiplomandInnen und DoktorandInnen bei Arbeiten mit Tandem-Thematikund Zugang zu PraktikumsplaumltzenOrientierung mit Hilfe des Forschungsregisters und Zugang zu unserer Materialsammlung(Praumlsenzbibliothek und Kopierservice)

Moumlglichkeit den Kongress Internationale TANDEM-Tage an der eigenen Einrichtung zu organisierenBeschleunigte Information uumlber Forschungs- und sonstige Grossprojekte Beratung und KontaktvermittlungKostenlose Zusendung des Newsletters TANDEM-Neuigkeiten dreimal jaumlhrlichfuumlr Mitglieder das Recht die Marke TANDEM und den Hinweis Mitglied derTandem-Stiftung zu fuumlhren fuumlr Lizenzinhaber Hinweis Eingetragener Verwender derTANDEM-Methode

Uumlber die konkreten Einzelleistungen hinaus bietet die Assoziation den Anschluss an ein Netzvon WissenschaftlerInnen und PraktikerInnen in derzeit 13 Laumlndern die einen grossenErfahrungspool zum Themenbereich Sprache-Kultur-Austausch bilden

Die Rechte und Pflichten sind in der Satzung genauer beschrieben

27N Mitglieder des StiftungsratsMitglieder des Stiftungsrats koumlnnen Einrichtungen werden die alle folgende Bedingungen erfuumlllena) Rechtsform als oumlffentliche Einrichtung oder gemeinnuumltziger Verein oder aumlhnliche die das WarenzeichenTANDEM nicht zur Werbung fuumlr Sprachkursverkauf verwenden In Laumlndern wo diese Rechtsform nichtbestehen koumlnnen vom Vorstand andere Formen zugelassen werdenb) ausreichende Garantien fuumlr die Stabilitaumlt der Einrichtungc) eine paumldagogische Linie die die Erweiterung oder Ersetzung der traditionellen LehrerInnenrolle durch dieVerwendung von Tandem-Verfahren kommunikationsfoumlrdernden Unterricht und einen interkulturellenAnsatz sowie die Anwesenheit verschiedener Kulturen in der Belegschaft umfasst

27a N LizenzenAn Einrichtungen die sich dem Sprachunterricht und dem interkulturellen Kontakt im Allgemeinen widmenund begruumlndetes Interesse an der Anwendung der Tandem-Methode haben koumlnnen Lizenzen zur Benutzungder Texte die zum Stiftungsvermoumlgen gehoumlren und des Warenzeichens TANDEM vergeben werden

31N Rechte der MitgliederDie Mitglieder haben das Rechta) alle Organe der Stiftung zu waumlhlen zu kontrollieren und abzuwaumlhlenb) sich fuumlr alle Organe zur Wahl zu stellenc) die Bezeichnung Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung zu verwendend) das urheberrechtlich geschuumltzte Material Nr 128568 und alles von Mitgliedern des Stiftungsrats fuumlrTandem-Aktivitaumlten erarbeitete Material zu verwendene)Tandem-Einzelvermittlung und damit verbundene Kurse durchzufuumlhrenf) an allen Projekten der Stiftung teilzunehmeng) ihre Erfahrungen zu veroumlffentlichen sofern dem nicht andere Bestimmungen dieser Satzungentgegenstehenh) von der Stiftung Aus- und Fortbildung zu guumlnstigeren Bedingungen als die Allgemeinheit zu erhalteni) dass alle ihre Angestellten an Sprachkursen von tandem International zu guumlnstigeren Bedingungen als dieAllgemeinheit teilnehmen

31b N Rechte der Lizenzinhaber Die Lizenzinhaber haben das Recht a) sich uumlber die Taumltigkeit des Vorstands zu informieren und mit Rede- und ohne Stimmrecht an denVersammlungen des Stiftungsrats teilzunehmenb) die Aufnahme in den Stiftungsrat zu beantragen wenn sie die Bedingungen erfuumlllenc) die Bezeichnung Eingetragener Verwender der Tandem-Methode sowie die in 31 d) e) f) g) h) i)genannten Rechte zu verwendenWeitere Rechte koumlnnen vertraglich festgelegt werden

32N Pflichten der Mitglieder

Die Mitglieder haben folgende Pflichtena) den Satz Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung und der Adressewwwtandemcityinfo in alle tandembezogene Werbung aufzunehmenb) nach dem Austritt keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt) entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode mit Angabe desNamens und der Sprechzeiten desr Tandemvermittlungs-Verantwortlichen der Einrichtung auszustellenh) Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen der Stiftung mitzuteileni) einen jaumlhrlichen Rundbrief uumlber Lage und Aktivitaumlten an alle Mitglieder zu uumlbersendenj) an den Vollversammlungen teilzunehmen und sie turnusmaumlssig zu organisierenk) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenu) dendie Tandemvermittlungs-Verantwortlichen durch den Einfuumlhrungskursden Fernkurs der Stiftungauszubildenv) die Ausbildungen spaumltestens alle fuumlnf Jahre durch den Praumlsenz- oder Fernkurs der Stiftung auf den neustenStand zu bringenw) die Kriterien fuumlr die Qualitaumlt der Vermittlung die die Stiftung entwickelt anzuwenden

32 b N Pflichten der LizenzinhaberDie Lizenzinhaber haben die Pflichta) die Bezeichnung Eingetragener Verwender der Tandem-Methode und die Adresse wwwtandemcityinfooder wwwtandemcitycom in alle tandembezogene Werbung aufzunehmenb) nach dem Ende der Lizenz keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode auszustellenh) der Stiftung Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen mitzuteileni) jaumlhrlich die von der Stiftung erbetenen statistischen Angaben uumlber den Einsatz der Tandem-Methode zuschicken(j) entfaumlllt) k) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)

o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenWeitere Pflichten koumlnnen vertraglich festgelegt werden

3 ENGLISH

Dear Colleagues

You are interested in the membership in Tandem Foundation created for universities and similar learning insti-tutions which dont offer language courses open to the general public but which wouldlike to implement within the institution itself or in exchange programs the Tandemsystemor a licence of use of Tandem material offer for any institution or school with a justifiedinterest in the application of tandem method in linguistic and cultural exchangesor you as a language school for foreigners wish to become member of the associationTandem International which includes a licence of use of Tandem material

Both membership status or licences offer the following advantages

1 Use of the material developed by the Tandem Network without paying royalties to theauthors eg the series of articles contained in the Self Access Tandem introductionPacket 2 Suggestions for Tandem Partners who practice the languages of Albanian ArabicBasque Bulgarian Czech Danish English French German Hungarian Italian LetonianPolish Portuguese Serbocroat Slovenian Spanish and Turkish (photocopied materialandor diskettes) 3 Suggestions for text comprehension by professional Tandem-partners in BasqueCzech English French German Italian Portuguese Slovenian and Spanish (photocopiedmaterial andor diskettes) 4 Free reception of all recent publications of Foundation eg books and CDs aboutmultilingual Babylonia-Tandem and cross-border Mugaz Gain 5 Participation in Foundation training seminars for two thirds of the regular price andthe option of jointly organising said courses 6 Participation of all employees (including those who have been contracted on an hourlybasis) in the language courses of the approximately 25 TANDEM International schoolsthroughout the world with discount now of a 20 7 Collaboration with university students and doctoral candidates who are working withthe subject of Tandem as well as providing them with access to professional trainingpositions 8 Professional orientation by means of the research register and access to our material(library and long distance photocopying service) 9 The possibility of organising the Tandem International Conference at ones own school 10 Free subscription to the TANDEM-Neuigkeiten bulletin which is publishedthree times a year 11 Rapid information about our research as well as other projects consultancyand service for making contacts

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

Moumlglichkeit den Kongress Internationale TANDEM-Tage an der eigenen Einrichtung zu organisierenBeschleunigte Information uumlber Forschungs- und sonstige Grossprojekte Beratung und KontaktvermittlungKostenlose Zusendung des Newsletters TANDEM-Neuigkeiten dreimal jaumlhrlichfuumlr Mitglieder das Recht die Marke TANDEM und den Hinweis Mitglied derTandem-Stiftung zu fuumlhren fuumlr Lizenzinhaber Hinweis Eingetragener Verwender derTANDEM-Methode

Uumlber die konkreten Einzelleistungen hinaus bietet die Assoziation den Anschluss an ein Netzvon WissenschaftlerInnen und PraktikerInnen in derzeit 13 Laumlndern die einen grossenErfahrungspool zum Themenbereich Sprache-Kultur-Austausch bilden

Die Rechte und Pflichten sind in der Satzung genauer beschrieben

27N Mitglieder des StiftungsratsMitglieder des Stiftungsrats koumlnnen Einrichtungen werden die alle folgende Bedingungen erfuumlllena) Rechtsform als oumlffentliche Einrichtung oder gemeinnuumltziger Verein oder aumlhnliche die das WarenzeichenTANDEM nicht zur Werbung fuumlr Sprachkursverkauf verwenden In Laumlndern wo diese Rechtsform nichtbestehen koumlnnen vom Vorstand andere Formen zugelassen werdenb) ausreichende Garantien fuumlr die Stabilitaumlt der Einrichtungc) eine paumldagogische Linie die die Erweiterung oder Ersetzung der traditionellen LehrerInnenrolle durch dieVerwendung von Tandem-Verfahren kommunikationsfoumlrdernden Unterricht und einen interkulturellenAnsatz sowie die Anwesenheit verschiedener Kulturen in der Belegschaft umfasst

27a N LizenzenAn Einrichtungen die sich dem Sprachunterricht und dem interkulturellen Kontakt im Allgemeinen widmenund begruumlndetes Interesse an der Anwendung der Tandem-Methode haben koumlnnen Lizenzen zur Benutzungder Texte die zum Stiftungsvermoumlgen gehoumlren und des Warenzeichens TANDEM vergeben werden

31N Rechte der MitgliederDie Mitglieder haben das Rechta) alle Organe der Stiftung zu waumlhlen zu kontrollieren und abzuwaumlhlenb) sich fuumlr alle Organe zur Wahl zu stellenc) die Bezeichnung Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung zu verwendend) das urheberrechtlich geschuumltzte Material Nr 128568 und alles von Mitgliedern des Stiftungsrats fuumlrTandem-Aktivitaumlten erarbeitete Material zu verwendene)Tandem-Einzelvermittlung und damit verbundene Kurse durchzufuumlhrenf) an allen Projekten der Stiftung teilzunehmeng) ihre Erfahrungen zu veroumlffentlichen sofern dem nicht andere Bestimmungen dieser Satzungentgegenstehenh) von der Stiftung Aus- und Fortbildung zu guumlnstigeren Bedingungen als die Allgemeinheit zu erhalteni) dass alle ihre Angestellten an Sprachkursen von tandem International zu guumlnstigeren Bedingungen als dieAllgemeinheit teilnehmen

31b N Rechte der Lizenzinhaber Die Lizenzinhaber haben das Recht a) sich uumlber die Taumltigkeit des Vorstands zu informieren und mit Rede- und ohne Stimmrecht an denVersammlungen des Stiftungsrats teilzunehmenb) die Aufnahme in den Stiftungsrat zu beantragen wenn sie die Bedingungen erfuumlllenc) die Bezeichnung Eingetragener Verwender der Tandem-Methode sowie die in 31 d) e) f) g) h) i)genannten Rechte zu verwendenWeitere Rechte koumlnnen vertraglich festgelegt werden

32N Pflichten der Mitglieder

Die Mitglieder haben folgende Pflichtena) den Satz Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung und der Adressewwwtandemcityinfo in alle tandembezogene Werbung aufzunehmenb) nach dem Austritt keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt) entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode mit Angabe desNamens und der Sprechzeiten desr Tandemvermittlungs-Verantwortlichen der Einrichtung auszustellenh) Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen der Stiftung mitzuteileni) einen jaumlhrlichen Rundbrief uumlber Lage und Aktivitaumlten an alle Mitglieder zu uumlbersendenj) an den Vollversammlungen teilzunehmen und sie turnusmaumlssig zu organisierenk) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenu) dendie Tandemvermittlungs-Verantwortlichen durch den Einfuumlhrungskursden Fernkurs der Stiftungauszubildenv) die Ausbildungen spaumltestens alle fuumlnf Jahre durch den Praumlsenz- oder Fernkurs der Stiftung auf den neustenStand zu bringenw) die Kriterien fuumlr die Qualitaumlt der Vermittlung die die Stiftung entwickelt anzuwenden

32 b N Pflichten der LizenzinhaberDie Lizenzinhaber haben die Pflichta) die Bezeichnung Eingetragener Verwender der Tandem-Methode und die Adresse wwwtandemcityinfooder wwwtandemcitycom in alle tandembezogene Werbung aufzunehmenb) nach dem Ende der Lizenz keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode auszustellenh) der Stiftung Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen mitzuteileni) jaumlhrlich die von der Stiftung erbetenen statistischen Angaben uumlber den Einsatz der Tandem-Methode zuschicken(j) entfaumlllt) k) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)

o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenWeitere Pflichten koumlnnen vertraglich festgelegt werden

3 ENGLISH

Dear Colleagues

You are interested in the membership in Tandem Foundation created for universities and similar learning insti-tutions which dont offer language courses open to the general public but which wouldlike to implement within the institution itself or in exchange programs the Tandemsystemor a licence of use of Tandem material offer for any institution or school with a justifiedinterest in the application of tandem method in linguistic and cultural exchangesor you as a language school for foreigners wish to become member of the associationTandem International which includes a licence of use of Tandem material

Both membership status or licences offer the following advantages

1 Use of the material developed by the Tandem Network without paying royalties to theauthors eg the series of articles contained in the Self Access Tandem introductionPacket 2 Suggestions for Tandem Partners who practice the languages of Albanian ArabicBasque Bulgarian Czech Danish English French German Hungarian Italian LetonianPolish Portuguese Serbocroat Slovenian Spanish and Turkish (photocopied materialandor diskettes) 3 Suggestions for text comprehension by professional Tandem-partners in BasqueCzech English French German Italian Portuguese Slovenian and Spanish (photocopiedmaterial andor diskettes) 4 Free reception of all recent publications of Foundation eg books and CDs aboutmultilingual Babylonia-Tandem and cross-border Mugaz Gain 5 Participation in Foundation training seminars for two thirds of the regular price andthe option of jointly organising said courses 6 Participation of all employees (including those who have been contracted on an hourlybasis) in the language courses of the approximately 25 TANDEM International schoolsthroughout the world with discount now of a 20 7 Collaboration with university students and doctoral candidates who are working withthe subject of Tandem as well as providing them with access to professional trainingpositions 8 Professional orientation by means of the research register and access to our material(library and long distance photocopying service) 9 The possibility of organising the Tandem International Conference at ones own school 10 Free subscription to the TANDEM-Neuigkeiten bulletin which is publishedthree times a year 11 Rapid information about our research as well as other projects consultancyand service for making contacts

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

Die Mitglieder haben folgende Pflichtena) den Satz Anerkannter Verwender der Tandem-Methode mit dem Logo der Stiftung und der Adressewwwtandemcityinfo in alle tandembezogene Werbung aufzunehmenb) nach dem Austritt keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt) entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode mit Angabe desNamens und der Sprechzeiten desr Tandemvermittlungs-Verantwortlichen der Einrichtung auszustellenh) Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen der Stiftung mitzuteileni) einen jaumlhrlichen Rundbrief uumlber Lage und Aktivitaumlten an alle Mitglieder zu uumlbersendenj) an den Vollversammlungen teilzunehmen und sie turnusmaumlssig zu organisierenk) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenu) dendie Tandemvermittlungs-Verantwortlichen durch den Einfuumlhrungskursden Fernkurs der Stiftungauszubildenv) die Ausbildungen spaumltestens alle fuumlnf Jahre durch den Praumlsenz- oder Fernkurs der Stiftung auf den neustenStand zu bringenw) die Kriterien fuumlr die Qualitaumlt der Vermittlung die die Stiftung entwickelt anzuwenden

32 b N Pflichten der LizenzinhaberDie Lizenzinhaber haben die Pflichta) die Bezeichnung Eingetragener Verwender der Tandem-Methode und die Adresse wwwtandemcityinfooder wwwtandemcitycom in alle tandembezogene Werbung aufzunehmenb) nach dem Ende der Lizenz keine Tandem-Aktivitaumlten gemaumlss Art 7 durchzufuumlhrenc) die fuumlr den Warenzeichenschutz zustaumlndige Abteilung der Stiftung uumlber Verletzungen des Warenzeichens inihrem Einflussbereich zu unterrichtend) die Beitraumlge zu bezahlene) die Obergrenze fuumlr die Tandem-Einzelvermittlung die jaumlhrlich vom Stiftungsrat festgelegt wird zubeachten(f alt entfaumlllt)f) ein Exemplar saumlmtlicher tandembezogener Veroumlffentlichungen und ihrer Broschuumlren an die dafuumlr zustaumlndigeAbteilung der Stiftung kostenlos zu uumlbersendeng) staumlndig ein von der Stiftung zur Verfuumlgung gestelltes Plakat uumlber die Tandem-Methode auszustellenh) der Stiftung Namen und E-Mail desr Tandemvermittlungs-Verantwortlichen mitzuteileni) jaumlhrlich die von der Stiftung erbetenen statistischen Angaben uumlber den Einsatz der Tandem-Methode zuschicken(j) entfaumlllt) k) zum Schutz vor NachahmerInnen das Symbol reg oder hinter dem Begriff TANDEM oder eine Fussnotebei wissenschaftlichen Texten anzubringenl) die Werbung der uumlbrigen Mitglieder und Lizenzinhaber in ihren Raumlumen auszulegen und die Stiftung inihren Veroumlffentlichungen als fuumlr Neumitglieder- und Lizenzinhaberinformation zustaumlndige AnsprechpartnerInzu nennenm) vor Aktivitaumlten in einer Stadt wo es ein anderes MitgliedLizenzinhaber gibt diese zu informieren(n) in m aufgenommen)

o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenWeitere Pflichten koumlnnen vertraglich festgelegt werden

3 ENGLISH

Dear Colleagues

You are interested in the membership in Tandem Foundation created for universities and similar learning insti-tutions which dont offer language courses open to the general public but which wouldlike to implement within the institution itself or in exchange programs the Tandemsystemor a licence of use of Tandem material offer for any institution or school with a justifiedinterest in the application of tandem method in linguistic and cultural exchangesor you as a language school for foreigners wish to become member of the associationTandem International which includes a licence of use of Tandem material

Both membership status or licences offer the following advantages

1 Use of the material developed by the Tandem Network without paying royalties to theauthors eg the series of articles contained in the Self Access Tandem introductionPacket 2 Suggestions for Tandem Partners who practice the languages of Albanian ArabicBasque Bulgarian Czech Danish English French German Hungarian Italian LetonianPolish Portuguese Serbocroat Slovenian Spanish and Turkish (photocopied materialandor diskettes) 3 Suggestions for text comprehension by professional Tandem-partners in BasqueCzech English French German Italian Portuguese Slovenian and Spanish (photocopiedmaterial andor diskettes) 4 Free reception of all recent publications of Foundation eg books and CDs aboutmultilingual Babylonia-Tandem and cross-border Mugaz Gain 5 Participation in Foundation training seminars for two thirds of the regular price andthe option of jointly organising said courses 6 Participation of all employees (including those who have been contracted on an hourlybasis) in the language courses of the approximately 25 TANDEM International schoolsthroughout the world with discount now of a 20 7 Collaboration with university students and doctoral candidates who are working withthe subject of Tandem as well as providing them with access to professional trainingpositions 8 Professional orientation by means of the research register and access to our material(library and long distance photocopying service) 9 The possibility of organising the Tandem International Conference at ones own school 10 Free subscription to the TANDEM-Neuigkeiten bulletin which is publishedthree times a year 11 Rapid information about our research as well as other projects consultancyand service for making contacts

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

o) der fuumlr die Neumitgliederwerbung zustaumlndigen Abteilung der Stiftung potentielle MitgliederLizenzinhabermitzuteilenp+q) entfaumllltr) nicht zu versuchen das Warenzeichen TANDEM allein oder in Verbindung auf sich einzutragens) keine Beteiligung an Firmen zu unterhalten die die obengenannten Pflichten verletzenWeitere Pflichten koumlnnen vertraglich festgelegt werden

3 ENGLISH

Dear Colleagues

You are interested in the membership in Tandem Foundation created for universities and similar learning insti-tutions which dont offer language courses open to the general public but which wouldlike to implement within the institution itself or in exchange programs the Tandemsystemor a licence of use of Tandem material offer for any institution or school with a justifiedinterest in the application of tandem method in linguistic and cultural exchangesor you as a language school for foreigners wish to become member of the associationTandem International which includes a licence of use of Tandem material

Both membership status or licences offer the following advantages

1 Use of the material developed by the Tandem Network without paying royalties to theauthors eg the series of articles contained in the Self Access Tandem introductionPacket 2 Suggestions for Tandem Partners who practice the languages of Albanian ArabicBasque Bulgarian Czech Danish English French German Hungarian Italian LetonianPolish Portuguese Serbocroat Slovenian Spanish and Turkish (photocopied materialandor diskettes) 3 Suggestions for text comprehension by professional Tandem-partners in BasqueCzech English French German Italian Portuguese Slovenian and Spanish (photocopiedmaterial andor diskettes) 4 Free reception of all recent publications of Foundation eg books and CDs aboutmultilingual Babylonia-Tandem and cross-border Mugaz Gain 5 Participation in Foundation training seminars for two thirds of the regular price andthe option of jointly organising said courses 6 Participation of all employees (including those who have been contracted on an hourlybasis) in the language courses of the approximately 25 TANDEM International schoolsthroughout the world with discount now of a 20 7 Collaboration with university students and doctoral candidates who are working withthe subject of Tandem as well as providing them with access to professional trainingpositions 8 Professional orientation by means of the research register and access to our material(library and long distance photocopying service) 9 The possibility of organising the Tandem International Conference at ones own school 10 Free subscription to the TANDEM-Neuigkeiten bulletin which is publishedthree times a year 11 Rapid information about our research as well as other projects consultancyand service for making contacts

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

12 For members the right to use the Tandem trademark and to declare onesstatus as Member of the Tandem Foundation for licensees status as Registered in useof TANDEM method

Apart from these specific services the association offers connection to a network of scientistsand professors for the moment in thirteen countries who have an extensive range of experi-ence in the area of cultural and language exchange

Rights and duties are described in a more exact way in the by-laws

27N = Members of the Foundation Council

Organizations can be admitted as members that fulfill the following requirementsa) legal form as public institution Charity and similar that do not use the trade mark TANDEM in theirpublicity to sell language courses The Committee of the Foundation can admit other forms for countries wherethese legal forms do not existb) exist the sufficient guarantees of stability of the organizationc) a pedagogical line that includes the extension or substitution of the traditional role of the teaching staff bythe tandem method and communicative teaching an intercultural approach and the presence of differentcultures between the personnel

27a N = LicensesLicenses that comprise the use of the texts of the original patrimony and the trade mark TANDEM can begranted to organizations dedicated to the teaching of languages and to the intercultural contact in general thathave justified interest on the application of the tandem method

31N Rights of the membersThe members will have the righta) to participate in the general assemblies with voice and vote and to choose to control and to dismiss all theorgans of the Foundationb) to present themselves to election for all the organs of the Foundationc) to use the denomination Recognized in use of the TANDEM method with the logo of the Foundationd) to use the material protected by the Registry of Intellectual Property of Madrid nr 128568 and all thematerial for tandem activities created by members of the Foundation Councile) to make individual tandem intermediation and courses combined with herf) to participate in all the projects of the Foundationg) to publish its experiences unless other dispositions of these by-laws oppose thath) to receive training of the Foundation in conditions more favorable than the public in generali) that all his employees participate in language courses of Tandem International in conditions more favorablethan the public in general

31 b N = Rights of the licensees The licensees will have the righta) to ask about the management of the Committee and to attend with voice without vote the Assemblies of theFoundation Councilb) to apply for being member when they fulfill the requirementsc) to use the denomination Registered in use of TANDEM methodand also the rights mentioned in 31 d) e) f) g) h) i)Additional rights can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

32N Duties of the membersThe members have toa) put the sentence Recognized in use of the TANDEM method with the logo of the Foundation and theaddress wwwtandemcityinfo in all its publicity referred to the tandem methodb) avoid activities tandem according to article 7 after withdrawal of the Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top that to receive by a tandem intermediation fixed annually by the FoundationCouncil(old f) suppressed)f) gratuitously send a unit of each publication referring to the tandem methodology and of its leaflets to theFoundationg) expose permanently a poster on the tandem method delivered by the Foundation with indication of theresponsible for tandem intermediations of the organization and its scheduleh) communicate name and electronic direction of its person in charge of intermediation to the Foundationi) send an annual circulate on its situation and activities to all the members of the Foundation Councilj) participate in the Assemblies of the Foundation Council and to organize themk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its seat and to mention the Foundation in itspublications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itn) (fused with m)o) communicate to the Foundation organizations that can be potential members or licenseessuppressed (p) q)r) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these duties(t) suppressedu) train the responsible for tandem intermediations by the presence or distance course of the Foundationv) update the training at least every 5 years by the presence or distance course of the Foundationw) apply the quality criteria for the tandem intermediation that develops the Foundation

32 b N Duties of the licenseesThe licensees will have toa) put the sentence registered in use of TANDEM method and the direction wwwtandemcityinfo orwwwtandemcitycom in all its publicity referred to the tandem methodb) avoid tandem activities according to article 7 after the withdrawal from Foundation Councilc) inform the department of the Foundation responsible for the trade mark protection about violations of theregistered trade mark in their sphere of influenced) pay the contributionse) respect the maximum top to receive by a tandem intermediation fixed annually by the Foundation Council(f old) suppressed)f) send a copy of each publication referring to the tandem methodology and of its leaflets gratuitously to theFoundationh) expose permanently a poster on the tandem method delivered by the Foundationi) communicate name and electronic direction of its person in charge of tandem intermediation to theFoundationj) send annually the statistical data on the use of the tandem method that requires the Foundationk) as protection against plagiarisms add the symbol reg or behind TANDEM or insert a footnote inacademic textsl) expose the publicity of the other members and licensees in its headquarters and mention the Foundation inits publications referred to tandem as interlocutor for organizations interested in becoming a member of theFoundation Council or licenseem) before initiating activities in a town where there is another member or licensee inform itr) not try to register the trade mark TANDEM single or combined for the own organizations) not have participation in companies that infringe these dutiesAdditional duties can be defined by contract

4 Cuotas Beitraumlge Fees - Tandem Fundazioa

Entrada y paquete de material Eintritt und Materialpaket Entry and material package

500 Euro

Curso de introduccioacuten (obligatorio para miembros y miembros de Tandem International) Einfuumlhrungskurs (Pflicht fuumlr Mitglieder und Mitglieder von Tandem International) Intro-ductory course (compulsory for members and members of Tandem International)

130 Euro (en autoestudio con tutorA als Selbstlernkurs mit TutorIn by Self Accesswith tutor 250 euro )

Cuota anual para licenciatarios (Tandem International y otros) a partir del segundo antildeo Jahresbeitrag fuumlr Lizenzinhaber (Tandem International und andere) ab dem zweiten Jahr Annual fee for licensees (Tandem International and others) beginning with the secondyear

450 Euro

Tandem International tiene su cuotas propias Tandem International hat eigene Beitraumlge Tandem International has its own fees

5 Interlocutores Ansprechpartner Interlocutors

Instituciones puacuteblicas que quieran ser miembros o licenciatarios Oumlffentliche Einrichtun-gen die Mitglied oder Lizenzinhaber werden wollen Public institutions which want tobecome members or licensees

gt Juumlrgen Wolff Tandem Fundazioa networktandem-forg

Escuelas de idiomas que quieren ser miembros de Tandem International Sprachschulendie Mitglied von Tandem International werden moumlchten Language schools which wantto become members of Tandem International

(la licencia de Tandem Fundazioa se gestionaraacute una vez solicitado el ingreso en TandemInternational die Lizenz von Tandem Fundazioa wird nach Eintrittsantrag in TandemInternational ausgestellt the license of Tandem Fundazioa will be granted after admis-sion applyment in Tandem International)

gt Oliver Lechlmair Tandem International Coordinator coordinatortandem-schoolscom

Escuelas de idiomas que soacutelo quieren la licencia de Tandem Fundazioa sin ser miembros deTandem International Sprachschulen die nur die Lizenz von Tandem Fundazioamoumlchten ohne Mitglied von Tandem International zu werden Language schools whichonly wish to get the license of Tandem Fundazioa without becoming member of TandemInternational

gt Juumlrgen Wolff Tandem Fundazioa networktandem-forg

53 Lizenzvertrag zwischen TANDEM International und TANDEM Fundazioa

( Versioacuten en castellano en el proacuteximo nuacutemero English version in the nr 27)

Lizenzvertrag

zwischen

der Stiftung TANDEM FundazioaPKApdo 864 E-20080 San Sebastiaacuten Spanien

nachfolgend Lizenzgeberin genanntvertreten durch ihre Praumlsidentin Susanna Buttaroni

und ihren Geschaumlftsfuumlhrer Juumlrgen Wolff

und

dem Verein TANDEM International eVco Sprachzentrum Goumlttingen Groner Str 57-58 D-37073 Goumlttingen

dem Lizenznehmervertreten durch seinen Vorsitzenden Juumlrgen Hinsenkamp und die Geschaumlftsfuumlhrer von

TANDEM Muumlnchen und TANDEM Hamburg Marcelo Avalos und Henning Pruumlszlig

sect 1Inhalt der Lizenzvereinbarung

1

Die Lizenzgeberin erklaumlrt dass sie als Inhaberin und Verfuumlgungsberechtigteder Wort- und Bildmarke TANDEM -Fahrradsymbol 1077922 in Spanien(2101985) 10867791 in Deutschland (1611986) 503057 international(351986) der Wortmarke TANDEM 39806820 in Deutschland(1351998) und 698260 international (8101998) und der BildmarkeSpirale 39806821 in Deutschland (2751998) und 69343 international(2471998) nach beiliegenden Urkunden (Anlage 1) eingetragen ist

2

Die Lizenzgeberin gewaumlhrt dem Lizenznehmer Lizenz fuumlr die Verwendung derWortmarke TANDEM 39806820 in Deutschland und 698260 internationalund der Bildmarke Spirale 39806821 in Deutschland und 69343international

3Der Lizenznehmer verpflichtet sich die Marke und die damit verbundenenRechte und Pflichten nur fuumlr die Vermarktung der Methode der Marke undseiner Mitgliedseinrichtungen zu verwenden Er gewaumlhrleistet daruumlberhinaus dass die in TANDEM International eV zusammengeschlossenenEinrichtungen die Marke und die damit verbundenen Rechte und Pflichtenrespektieren und sie ebenfalls nur fuumlr diese Zwecke verwenden

4

Der Lizenznehmer verpflichtet sich diesen Vertrag im Namen jeder einzelnenseiner Mitgliedseinrichtungen einzugehen

5

Die Lizenzgeberin vergibt die in sect 21 genannte Lizenz weltweit an TANDEMInternational eV und verpflichtet sich keine gleiche Lizenz an andereEinrichtungen zu vergeben Einzellizenzen die vor Unterzeichnung diesesVertrages mit Mitgliedern von TANDEM International eV abgeschlossenwurden verlieren dadurch ihre Guumlltigkeit 6 Der Lizenznehmer TANDEM International eV nimmt ausschlieszliglichEinrichtungen als Mitglieder auf die von der Lizenzgeberin akkreditiertwurden Fuumlr die bisherigen Alt-Mitglieder (Aufnahme vor dem 31072003)wird die Akkreditierung durch Einsendung eines Datenblatts (Anlage 2) alserfolgt voraus gesetzt

sect 2 Lizenzprodukte und Markenzeichen

1Lizenzprodukte sind- die eingetragene Marke mit Spiralsymbol TANDEM (Wort- und Bildmarke vgl Anlage 3)- das Recht von in TANDEM International eV zusammen geschlossenen Einrichtungen das Wort TANDEM plus Ortsnamen des Sitzes der Einrichtungen als ausschlieszliglichen Firmennamen zu fuumlhrenMarkenanmeldungen mit TANDEM werden nur von der Lizenzgeberingetaumltigt

2Die eingetragene Marke mit Spiralsymbol TANDEM verbunden mit demSymbol reg (Anlage 3) ist auf der Homepage der Hauptbroschuumlre und aufBuch- und CD-Publikationen jeder Mitgliedseinrichtung des Lizenznehmers inunveraumlnderter Form anzubringen Auf der Homepage von TANDEM Interna-tional wird daruumlber hinaus der Vermerk TANDEM ist eine eingetrageneMarke der TANDEM Fundazioa angebracht Beide Vertragspartner inform-ieren sich gegenseitig uumlber die Anmeldung von Internet-Domains auf ihrenNamen

3Das Recht zur Nutzung aller unter 21 genannten Lizenzprodukte im Sinnedieses Vertrages wird weder durch den Lizenznehmer noch durch dieLizenzgeberin an Dritte weiter gegeben

sect 3Beratung und Auskunftspflicht durch die Lizenzgeberin

1Die Lizenzgeberin bietet die Beratung von Personen und Institutionen an diean der Tandem-Methode interessiert sind Sie leitet Anfragen von an einerMitgliedschaft interessierten Einrichtungen (Sprachenschulen) an denLizenznehmer weiter Die Beratung schlieszligt ein kostenpflichtiges Angebot derSchulung der in den Mitgliedseinrichtungen des Lizenznehmers Taumltigen(paumldagogisches Personal) insbesondere zur Hebung des Qualitaumltsstandardsder Tandem-Vermittlungen mit ein

2Sie verpflichtet sich eingehende Antraumlge auf Akkreditierung innerhalb einerFrist von maximal 4 Wochen nach vollstaumlndigem Eingang zu bescheiden

3

Die Lizenzgeberin wird den Lizenznehmer vor der Vergabe von Lizenzen alsregistered in use of the TANDEM method an Einrichtungen die nichtMitglied bei dem Lizenznehmer sind benachrichtigen

4

Die Lizenzgeberin legt auf ihrer WebSite einen deutlichen Link zu derdenDomains des Lizenznehmers

sect 4Beratung und Auskunftspflicht durch den Lizenznehmer

1Der Lizenznehmer bietet die Beratung von an einer Mitgliedschaft interessier-ten Einrichtungen (Sprachenschulen) an Er leitet Anfragen von Personenund Institutionen die an der Tandem-Methode interessiert sind an dieLizenzgeberin weiter

Der Lizenznehmer erklaumlrt bindend dass die folgenden Voraussetzungen fuumlrdie Akkreditierung seiner Mitgliedseinrichtungen erfuumlllt werden

Die Mitgliedseinrichtunga) dokumentiert ein begruumlndetes Interesse fuumlr die TANDEM-Methode durch Vermittlung von Sprachlernpartnerschaften vor Ort und oder in Form vonOnline-Angeboten (eTandem Self Study Kurse mit Austausch-Anteil) inner-halb von 6 Monaten nach Akkreditierung

b) respektiert den Houmlchstbetrag der fuumlr die Vermittlung von TANDEM-Partnerschaften durch die Teilnehmerinnen zu zahlen ist Die Einzelheitenwerden in der Anlage 4 zum Vertrag (Gebuumlhrentabelle) geregelt

c) unterrichtet die Lizenzgeberin uumlber alle von ihr verfassten Publikationendie sich auf die TANDEM-Methode beziehen und schickt ihr kostenfrei je einExemplar

d) benennt alle fuumlr den Bereich TANDEM-Sprachlernpartnerschaften zustaumln-digen Ansprechpartnerinnen

e) nennt die Stiftung TANDEM Fundazioa in Veroumlffentlichungen alsAnsprechpartnerin fuumlr Lehrerfortbildung und Forschung

f) legt auf der eigenen WebSite einen deutlichen Link zu derden Domain(s)der Lizenzgeberin

g) informiert die Lizenzgeberin bei Verletzungen der Marke durch Dritte inihrem Bereich

h) beantwortet einmal jaumlhrlich eine Umfrage der Lizenzgeberin zum Einsatzder Tandem-Methode

Verstoumlszlige gegen Voraussetzung a) fuumlhren zum Widerruf der AkkreditierungBei Bekanntwerden von Verstoumlszligen gegen b) bis h) wird der Lizenznehmer diebetroffene Einrichtung zur Einhaltung des Vertrags innerhalb einer Frist vonmaximal 6 Wochen veranlassen Geschieht dies nicht kann die Lizenzgeberinden Versand von kostenlosem Material fuumlr die Dauer des Verstoszligesaussetzen

2Der Lizenznehmer wird alle an einer Mitgliedschaft interessierten Einrichtun-gen (Sprachenschulen) uumlber die Taumltigkeit der Stiftung und die Notwendigkeiteiner Akkreditierung durch die Lizenzgeberin informieren Er wird Institu-tionen erst zu dem Zeitpunkt endguumlltig als Mitglieder und in seine Werbe-traumlger aufnehmen an dem die Akkreditierung durch die Lizenzgeberin erfolgtist Beantragenden Einrichtungen wird nach Begutachtung und (positiver)Beurteilung des Antrages auf Mitgliedschaft beim Lizenznehmer eine Fristvon maximal 4 Wochen zur Bewerbung um die Akkreditierung bei derLizenzgeberin eingeraumlumt sowie eine Jahresfrist einen oder mehrereTeilnehmerinnen zum TANDEM-Einfuumlhrungskurs zu senden bzw denFernkurs abzuschlieszligen Werden keine Teilnehmerinnen entsandt oder derFernkurs nicht abgeschlossen kann die Lizenzgeberin die Akkreditierungwiderrufen

3 Der Lizenznehmer uumlbersendet der Lizenzgeberin alle Anfragen um Mitglied-schaft die nicht zur Aufnahme in Tandem International fuumlhrten spaumltestens 6Monate nach der ersten Anfrage mit Name des Ansprechpartners undE-Mail-Adresse damit Tandem Fundazioa ihnen eine Lizenz registered in useof the TANDEM method anbieten kann

sect 5Lizenzgebuumlhr und sonstige Kosten

1Der Lizenznehmer zahlt an die Lizenzgeberin eine jaumlhrliche Gebuumlhr derenHoumlhe sich aus der Zahl der Mitgliedseinrichtungen des Lizenznehmersmultipliziert mit der in Anlage 4 genannten Gebuumlhr errechnet Diese Gebuumlhrwird jaumlhrlich in houmlchstens zwei Ratenzahlungen entrichtet wobei die ersteRate mindestens 70 der Gesamtsumme betraumlgt und spaumltestens bis zum31 Januar jeden Jahres die Restsumme bis zum 28 Februar des selbenJahres zu uumlberweisen ist Bei Zahlungsverzug koumlnnen uumlbliche Mahngebuumlhrenerhoben werden

Fuumlr neu eintretende Einrichtungen zahlt der Lizenznehmer im ersten Jahranstelle der jaumlhrlichen Lizenzgebuumlhr an die Lizenzgeberin eine einmaligeErstlizenz und eine Gebuumlhr fuumlr einen TANDEM-Einfuumlhrungskurs Naumlheresregelt Anlage 4

Die Zahlung der Erstlizenz und der Gebuumlhr fuumlr einen TANDEM-Einfuumlhrungskurs wird fuumlr neu eintretende Einrichtungen mit Ausstellung derAkkreditierung faumlllig

Bleiben oben genannte Gebuumlhren nach Faumllligkeitsdatum unbezahlt kanndie Lizenzgeberin bereits erteilte Akkreditierungen nach sechs Wochenwiderrufen

sect 6Dauer und Beendigung des Lizenzvertrags

1 Der Lizenzvertrag wird auf unbestimmte Zeit geschlossen Er beginnt am8112003 Vereinbarungen betreffend sect 5 gelten ebenso ab diesem Datummit Ausnahme der Regelung uumlber die Lizenzgebuumlhr fuumlr die Altmitglieder desLizenznehmers (Einrichtungen die vor dem 31072003 bereits Mitgliedersind) Diese Regelung gilt fuumlr sie erst ab dem 112004 da bereits vorherVereinbarungen uumlber Gebuumlhren fuumlr das Kalenderjahr 2003 getroffen wurden

2 Der Lizenzvertrag kann mit einer dreimonatigen Frist zum Jahre-swechsel erstmalig zum 112007 gekuumlndigt werden

3Beide Seiten haben das Recht den Vertrag bei Vorliegen von schwer wiegen-den Vertragsverletzungen nach einer Anmahnung mit einem Monat Frist zurNachbesserung zu kuumlndigen Eine Kuumlndigung aus wichtigem Grund ist jeder-zeit moumlglich

sect 7Vertragsaumlnderungen

1Aumlnderungen und Ergaumlnzungen dieses Vertrags sowie Nebenabreden sind nurwirksam wenn sie schriftlich abgeschlossen oder schriftlich wechselseitigbestaumltigt worden sind

2

Die Houmlhe der vereinbarten Lizenzgebuumlhr wird turnusmaumlszligig alle drei Jahre(erstmalig zum 112007) oder bei Eintreten wichtiger Gruumlnde zwischen derLizenzgeberin und dem Lizenznehmer neu verhandelt

sect 8Salvatorische Klausel

Sollten einzelne Bestimmungen dieses Vertrags unguumlltig sein oder werdenberuumlhrt dies die Wirkung der uumlbrigen Bestimmungen nicht Anstelle derunwirksam gewordenen Bestimmung ist eine Regelung zu vereinbaren dieder im vorliegenden Lizenzvertrag beabsichtigten Zielsetzung am naumlchstenkommt

sect 9Gerichtsstand

Gerichtsstand bei Klagen ist der Rechtssitz des jeweiligen Beklagten

f) legt auf der eigenen WebSite einen deutlichen Link zu derden Domain(s)der Lizenzgeberin

g) informiert die Lizenzgeberin bei Verletzungen der Marke durch Dritte inihrem Bereich

h) beantwortet einmal jaumlhrlich eine Umfrage der Lizenzgeberin zum Einsatzder Tandem-Methode

Verstoumlszlige gegen Voraussetzung a) fuumlhren zum Widerruf der AkkreditierungBei Bekanntwerden von Verstoumlszligen gegen b) bis h) wird der Lizenznehmer diebetroffene Einrichtung zur Einhaltung des Vertrags innerhalb einer Frist vonmaximal 6 Wochen veranlassen Geschieht dies nicht kann die Lizenzgeberinden Versand von kostenlosem Material fuumlr die Dauer des Verstoszligesaussetzen

2Der Lizenznehmer wird alle an einer Mitgliedschaft interessierten Einrichtun-gen (Sprachenschulen) uumlber die Taumltigkeit der Stiftung und die Notwendigkeiteiner Akkreditierung durch die Lizenzgeberin informieren Er wird Institu-tionen erst zu dem Zeitpunkt endguumlltig als Mitglieder und in seine Werbe-traumlger aufnehmen an dem die Akkreditierung durch die Lizenzgeberin erfolgtist Beantragenden Einrichtungen wird nach Begutachtung und (positiver)Beurteilung des Antrages auf Mitgliedschaft beim Lizenznehmer eine Fristvon maximal 4 Wochen zur Bewerbung um die Akkreditierung bei derLizenzgeberin eingeraumlumt sowie eine Jahresfrist einen oder mehrereTeilnehmerinnen zum TANDEM-Einfuumlhrungskurs zu senden bzw denFernkurs abzuschlieszligen Werden keine Teilnehmerinnen entsandt oder derFernkurs nicht abgeschlossen kann die Lizenzgeberin die Akkreditierungwiderrufen

3 Der Lizenznehmer uumlbersendet der Lizenzgeberin alle Anfragen um Mitglied-schaft die nicht zur Aufnahme in Tandem International fuumlhrten spaumltestens 6Monate nach der ersten Anfrage mit Name des Ansprechpartners undE-Mail-Adresse damit Tandem Fundazioa ihnen eine Lizenz registered in useof the TANDEM method anbieten kann

sect 5Lizenzgebuumlhr und sonstige Kosten

1Der Lizenznehmer zahlt an die Lizenzgeberin eine jaumlhrliche Gebuumlhr derenHoumlhe sich aus der Zahl der Mitgliedseinrichtungen des Lizenznehmersmultipliziert mit der in Anlage 4 genannten Gebuumlhr errechnet Diese Gebuumlhrwird jaumlhrlich in houmlchstens zwei Ratenzahlungen entrichtet wobei die ersteRate mindestens 70 der Gesamtsumme betraumlgt und spaumltestens bis zum31 Januar jeden Jahres die Restsumme bis zum 28 Februar des selbenJahres zu uumlberweisen ist Bei Zahlungsverzug koumlnnen uumlbliche Mahngebuumlhrenerhoben werden

Fuumlr neu eintretende Einrichtungen zahlt der Lizenznehmer im ersten Jahranstelle der jaumlhrlichen Lizenzgebuumlhr an die Lizenzgeberin eine einmaligeErstlizenz und eine Gebuumlhr fuumlr einen TANDEM-Einfuumlhrungskurs Naumlheresregelt Anlage 4

Die Zahlung der Erstlizenz und der Gebuumlhr fuumlr einen TANDEM-Einfuumlhrungskurs wird fuumlr neu eintretende Einrichtungen mit Ausstellung derAkkreditierung faumlllig

Bleiben oben genannte Gebuumlhren nach Faumllligkeitsdatum unbezahlt kanndie Lizenzgeberin bereits erteilte Akkreditierungen nach sechs Wochenwiderrufen

sect 6Dauer und Beendigung des Lizenzvertrags

1 Der Lizenzvertrag wird auf unbestimmte Zeit geschlossen Er beginnt am8112003 Vereinbarungen betreffend sect 5 gelten ebenso ab diesem Datummit Ausnahme der Regelung uumlber die Lizenzgebuumlhr fuumlr die Altmitglieder desLizenznehmers (Einrichtungen die vor dem 31072003 bereits Mitgliedersind) Diese Regelung gilt fuumlr sie erst ab dem 112004 da bereits vorherVereinbarungen uumlber Gebuumlhren fuumlr das Kalenderjahr 2003 getroffen wurden

2 Der Lizenzvertrag kann mit einer dreimonatigen Frist zum Jahre-swechsel erstmalig zum 112007 gekuumlndigt werden

3Beide Seiten haben das Recht den Vertrag bei Vorliegen von schwer wiegen-den Vertragsverletzungen nach einer Anmahnung mit einem Monat Frist zurNachbesserung zu kuumlndigen Eine Kuumlndigung aus wichtigem Grund ist jeder-zeit moumlglich

sect 7Vertragsaumlnderungen

1Aumlnderungen und Ergaumlnzungen dieses Vertrags sowie Nebenabreden sind nurwirksam wenn sie schriftlich abgeschlossen oder schriftlich wechselseitigbestaumltigt worden sind

2

Die Houmlhe der vereinbarten Lizenzgebuumlhr wird turnusmaumlszligig alle drei Jahre(erstmalig zum 112007) oder bei Eintreten wichtiger Gruumlnde zwischen derLizenzgeberin und dem Lizenznehmer neu verhandelt

sect 8Salvatorische Klausel

Sollten einzelne Bestimmungen dieses Vertrags unguumlltig sein oder werdenberuumlhrt dies die Wirkung der uumlbrigen Bestimmungen nicht Anstelle derunwirksam gewordenen Bestimmung ist eine Regelung zu vereinbaren dieder im vorliegenden Lizenzvertrag beabsichtigten Zielsetzung am naumlchstenkommt

sect 9Gerichtsstand

Gerichtsstand bei Klagen ist der Rechtssitz des jeweiligen Beklagten

Die Zahlung der Erstlizenz und der Gebuumlhr fuumlr einen TANDEM-Einfuumlhrungskurs wird fuumlr neu eintretende Einrichtungen mit Ausstellung derAkkreditierung faumlllig

Bleiben oben genannte Gebuumlhren nach Faumllligkeitsdatum unbezahlt kanndie Lizenzgeberin bereits erteilte Akkreditierungen nach sechs Wochenwiderrufen

sect 6Dauer und Beendigung des Lizenzvertrags

1 Der Lizenzvertrag wird auf unbestimmte Zeit geschlossen Er beginnt am8112003 Vereinbarungen betreffend sect 5 gelten ebenso ab diesem Datummit Ausnahme der Regelung uumlber die Lizenzgebuumlhr fuumlr die Altmitglieder desLizenznehmers (Einrichtungen die vor dem 31072003 bereits Mitgliedersind) Diese Regelung gilt fuumlr sie erst ab dem 112004 da bereits vorherVereinbarungen uumlber Gebuumlhren fuumlr das Kalenderjahr 2003 getroffen wurden

2 Der Lizenzvertrag kann mit einer dreimonatigen Frist zum Jahre-swechsel erstmalig zum 112007 gekuumlndigt werden

3Beide Seiten haben das Recht den Vertrag bei Vorliegen von schwer wiegen-den Vertragsverletzungen nach einer Anmahnung mit einem Monat Frist zurNachbesserung zu kuumlndigen Eine Kuumlndigung aus wichtigem Grund ist jeder-zeit moumlglich

sect 7Vertragsaumlnderungen

1Aumlnderungen und Ergaumlnzungen dieses Vertrags sowie Nebenabreden sind nurwirksam wenn sie schriftlich abgeschlossen oder schriftlich wechselseitigbestaumltigt worden sind

2

Die Houmlhe der vereinbarten Lizenzgebuumlhr wird turnusmaumlszligig alle drei Jahre(erstmalig zum 112007) oder bei Eintreten wichtiger Gruumlnde zwischen derLizenzgeberin und dem Lizenznehmer neu verhandelt

sect 8Salvatorische Klausel

Sollten einzelne Bestimmungen dieses Vertrags unguumlltig sein oder werdenberuumlhrt dies die Wirkung der uumlbrigen Bestimmungen nicht Anstelle derunwirksam gewordenen Bestimmung ist eine Regelung zu vereinbaren dieder im vorliegenden Lizenzvertrag beabsichtigten Zielsetzung am naumlchstenkommt

sect 9Gerichtsstand

Gerichtsstand bei Klagen ist der Rechtssitz des jeweiligen Beklagten

Anerkenntnis der Vertragsvereinbarungen

Ort Datum Unterschrift Lizenzgeberin

Ort Datum Unterschrift Lizenznehmer

54 Das Letzte Kommentar von Lucia zu dieser Nummer

O dada mam bebe uhuh

Da wird sie wohl recht haben